KEGG   Danio rerio (zebrafish): 798703Help
Entry
798703            CDS       T01004                                 

Definition
gemin 7-like
Orthology
K13135  
gem associated protein 7
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    798703
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    798703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 125 aa AA seqDB search
MKTPVGVLRLPRGPEPNSRGFDPNSPRFQALCPTSLTSSSSSSSVDVEEQRLRAEQREHF
LRTLLLMTDKRVDFQLLEKLRMRGRFGASDIDVLNFQVSDLETPLGVQKEALLRCHDIIS
CSFEL
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgaagactccagtcggtgttctcaggctgccaagaggaccggagccaaacagtcgaggg
tttgacccaaattctcctcgtttccaggctctctgccccacatctctgacctcctcatct
tcatcctcctctgtggacgttgaagagcagcggctgcgggcggagcagcgcgagcatttt
ctgcggactctcctcctcatgacggacaaacgcgtcgactttcagctgctggagaagctg
cgcatgcgcggtcggttcggcgcctcagacatcgatgtgctgaattttcaggtgtccgat
ctggagactccgctcggcgtgcagaaagaggctcttctcaggtgtcacgatattatttcc
tgctcgtttgaactgtaa

DBGET integrated database retrieval system