KEGG   Danio rerio (zebrafish): 798788Help
Entry
798788            CDS       T01004                                 

Gene name
gpx3
Definition
glutathione peroxidase 3 (plasma) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    798788 (gpx3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    798788 (gpx3)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     798788 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
14
AA seq 222 aa AA seqDB search
MGTQSNPWTSVVLLLALMHKIAALSNTQACNSAAGDSFHNYGAKTINGTQFIPFSHYAGK
HVLVVNVATYUGLTFQYVELNALHEELRHLGFTILGFPCDQFGKQEPGENNEILSALKYV
RPGNGFVPNFQLFEKGDVNGDGEQALFTFLKNACPPVGESFGATSNRLFWEPLKVNDIKW
NFEKFLLDPDGRPVMRWFPRVNVSEVRADILKYFHQLLQTAQ
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggggactcagagcaacccctggacctctgttgtgcttctgctggctctaatgcacaag
atagcagcactgtccaacacccaggcctgtaactcggcagctggagactcttttcacaac
tacggtgcaaaaaccataaacgggacgcagttcatcccgttctctcattacgctggaaaa
cacgtcctcgtggtcaacgtggccacctactgaggactgaccttccagtacgtggaactg
aatgcactacacgaggagcttcgccatctgggattcaccatcctcggctttccttgcgac
caattcgggaaacaagaacctggagaaaacaatgaaattctttctgcattgaagtatgtc
cgtccaggaaatggattcgttcctaatttccagttatttgagaagggagatgtgaatgga
gacggagagcaggcccttttcacattcctaaagaacgcatgtccgcctgtaggagagagt
tttggggccaccagcaacaggctgttttgggaaccgctgaaagtcaatgacatcaagtgg
aactttgagaagtttctgctggatccagatggcaggcctgtgatgcgctggttccccaga
gtcaacgtgtctgaagtcagagcagacatcctcaaatacttccatcagcttctgcagact
gcacagtaa

DBGET integrated database retrieval system