KEGG   Danio rerio (zebrafish): 799085Help
Entry
799085            CDS       T01004                                 

Gene name
abhd6a
Definition
(RefSeq) monoacylglycerol lipase abhd6-A
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     799085 (abhd6a)
Peptidases [BR:dre01002]
 Serine Peptidases
  Family S33
   799085 (abhd6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
11
AA seq 339 aa AA seqDB search
MDLDVLNMFLIAGGTLAIPILAFVASFLLWPATLIKVYHWYWRRRLGMQVDYAEYEGYRF
CYSHRGNPGFRPSVLMLHGFSAHKDMWLGVVKFLPKNVHLICVDMPGHEGTSRTSAVDYS
IEGQVKRINQFVKSIGLNKKPFHLIGTSMGGNVAGVYAARHPSELCGVTLICPAGLQYPT
ESKFVERLRELEKTQDRDGIPLIPSTPEQMEEMLKLCSYVRFKIPKQILQGLVDVRIPNN
DFYHECFMELVGEKSRHSLHENMHLISTPLQVIWGKNDQVLDVSGASVLSGAVPGCQVHL
LDNCGHSVVLERPRKSAQLITDFIIAQQNAGINSNKKLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggatctggacgtcctgaacatgttcttgattgccggcgggactctggcgatccccatc
ctggcgttcgtagcctcgttcctgctctggccggccacgcttattaaagtttatcactgg
tattggcgcagacggctggggatgcaggtggattatgctgaatatgaaggttatcgattc
tgttactctcacagaggaaatccaggctttcgtccatctgttttaatgctgcacggcttt
tctgcacacaaagacatgtggctcggggtggtgaagtttctccctaaaaatgtgcacttg
atatgtgtggacatgccgggacatgaaggtacatcacgcaccagcgctgtggattattcc
atagagggccaagtcaaacgcattaatcagtttgtgaagagcattggactgaacaaaaag
cctttccatctgatcggcacatctatgggtggaaatgtagcaggagtttatgcagctcgt
cacccatctgaactctgcggcgtcacactcatctgtcctgcaggtcttcagtatcccact
gaaagtaagtttgttgagcgtttgagggagctggagaaaacgcaggacagagatgggatc
ccgctgatcccctccacacccgagcagatggaggagatgctcaaactctgctcatacgtg
cgctttaagatccccaaacagatacttcaaggactggttgacgttcgcatcccaaacaat
gacttctaccacgagtgttttatggagcttgttggagaaaaatcccgacactctttacac
gagaacatgcatctcatttcaactcctctacaggttatttgggggaaaaatgaccaggtt
ttagacgtgtctggagcttcagttttgtctggagccgttcccggatgccaggttcatcta
ctagacaactgtgggcactcggtagtgttggagcggcctagaaaatctgcccagctcatc
acagacttcatcatcgcacaacagaacgcaggaatcaacagcaacaagaaactctcctaa

DBGET integrated database retrieval system