KEGG   Danio rerio (zebrafish): 81882Help
Entry
81882             CDS       T01004                                 

Gene name
dhfr, cb595, zgc:86637
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    81882 (dhfr)
   00670 One carbon pool by folate
    81882 (dhfr)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     81882 (dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
5
AA seq 190 aa AA seqDB search
MSRILNCIVAVCPDMGIGKNGNLPWHPIRLSNELKHFQKMTMTPSDEGKKNVVIMGRKTW
FSIPAAHRPLKNRINIVLSRELKTAPEGAHYLASDFSSALHLLDSGELEKLVDQVWIIGG
SSLYKEVMERSGHRRLFVTRILKQFDCDTFIPNFDMDKYKLLPEFPGVPVGLQEDNGVQY
LFEVYESIKH
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaatactcaactgtattgtagctgtttgtccagacatgggaatagggaaaaat
ggaaacctgccatggcatccaataagactaagtaatgaactcaagcactttcagaagatg
accatgaccccttcagatgagggtaagaagaatgtggtcatcatgggcagaaagacatgg
ttctctattcctgcagcgcacagacctctaaagaacaggatcaacatagttctcagcaga
gaactcaagacagccccagagggagctcactaccttgcttcagacttcagttcagctctc
catctgttagacagtggcgagctcgaaaaactagtggaccaggtttggataattggtggc
agctctttgtataaggaggtgatggagcgctctggtcacaggcgtctgtttgtaacccgc
atcctcaagcagtttgactgtgacacatttatacccaattttgacatggacaagtacaag
ctactgcctgaatttccaggtgtacccgttggcttgcaggaggacaatggtgttcagtat
ttgtttgaagtgtatgaaagcatcaaacactaa

DBGET integrated database retrieval system