KEGG   Danio rerio (zebrafish): 84039Help
Entry
84039             CDS       T01004                                 

Gene name
bcmo1, b-diox, bcdo, bcdo1, bcmo1a, bcox
Definition
beta-carotene 15,15'-monooxygenase 1 (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
dre  Danio rerio (zebrafish)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    84039 (bcmo1)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     84039 (bcmo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
17
AA seq 516 aa AA seqDB search
MQYDYGKNKEEHPEPIKTEVKGSIPEWVQGTLIRNGPGMFSVGETTYNHWFDGMALLHSF
AINKGEVTYRSRYLRGDTYNSNMQANRIVVSEMGTMAYPDPCKNIFSKVITFLSHTIPDF
TDNCGNNIIKYGNDFHATSETNYIRKIDPVTLETQEKIDYLKYLPVSIVASHTHYDKEGN
SYSMGTCIAEKGKTKYMLFKVPGESRPDGSPPLKSAEAVCTLPCRSLLTPSYYHSFGMTD
NYFIFIEQPLKLDILKMATAYLRRVSWASCMKFHPEDSTLIHLIDRNTKKEVATKFYTDA
MTVYHQVNAFEDDGHVVFDVIAYDDNNLYEFFYLNKLKETMGATNLYCKPKFTRFVFPLS
DQGETGENLVKLKYTTASAVKEKDGKIMCQGEVLCEGVELPRINYNFNGKKYRYSYMCCV
DESPVATRIVKFDADTKQQIEWKGDDGFASEPVFIPRPGAVDEDDGVVLTVIINNKPLQG
GFLLVLDAKSFKEIARACLDVEIHMDMHGYFIPGSS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacgactatggcaaaaacaaggaagaacatccggagcccatcaaaactgaagta
aagggctcgattcctgaatgggtgcagggaacactaatacgcaatggacctggcatgttc
tctgttggagagacgacatacaaccattggtttgatggaatggcacttttgcacagtttt
gcaattaataaaggagaggtgacgtacaggagcagatatcttcgaggtgacacctataac
tccaacatgcaggccaatagaatagtagtctcggagatggggaccatggcgtacccggac
ccatgcaaaaacatattctccaaagtgatcaccttcctcagccacaccatcccagacttc
actgacaactgtgggaataacataatcaaatatggaaatgacttccatgctacgtctgaa
actaattatattcggaaaattgaccctgttactttagagactcaggaaaagattgactac
ctgaaataccttcctgtaagtatcgtggcttctcatacacattatgacaaagagggaaac
agctacagtatgggaacatgcatcgcggagaagggcaaaaccaaatacatgttgttcaag
gtcccaggagaaagcaggccagatggatctccacctttgaaaagcgctgaggctgtgtgc
accctgccctgccgttccctcctcacgccaagttactaccacagctttggcatgaccgac
aactacttcatcttcatcgagcaacccttgaagctggatatcctaaaaatggccacggct
tatttgaggagggtgagctgggccagctgcatgaagtttcaccctgaagacagtacactc
attcatcttattgaccgaaacacaaaaaaggaggttgcgaccaaattctacactgatgca
atgaccgtctaccatcaagtcaatgcctttgaagacgatgggcatgttgtttttgacgtg
attgcctatgatgacaacaacttgtatgaattcttttacctgaacaagctgaaggagacg
atgggagcaacaaatttgtactgcaaacccaagttcacaagatttgtgtttccccttagt
gaccagggtgagacaggtgagaatctggtcaaacttaaatacacaacagcaagtgctgtg
aaggagaaagatgggaaaataatgtgtcagggagaggttctatgtgaaggtgtggaactt
ccaagaattaattacaacttcaatggaaagaagtacagatattcttacatgtgttgtgta
gatgaatccccagtggccacaaggattgtgaagtttgatgctgacacaaagcagcagatt
gagtggaaaggagatgacggttttgcatcagagcctgttttcattcccaggcctggtgca
gttgatgaagatgatggtgtagtcctgacagttatcattaataacaaacctctgcagggt
ggctttctactggtgcttgatgccaagtctttcaaagagattgcccgggcatgcttagat
gtagaaattcacatggacatgcatggatacttcataccaggcagcagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system