KEGG   Desulfotomaculum reducens: Dred_0044Help
Entry
Dred_0044         CDS       T00494                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
drm  Desulfotomaculum reducens
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:drm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
54738..55340
Genome map
AA seq 200 aa AA seqDB search
MLYYSGPVARLVDEFAKLPGIGPKTAQRLAFHVLNSPPELAQGLAKALVEVRQSIKRCSL
CCNLTDEDPCSICQDTTRNSNLLCVVEEPRDVIAMEKARGYRGYYHVLHGAISPMEGIRP
EDLTIKELLHRLQNGDIQEVILAANSDVEGETTALYLARLLKPLGVKVTRIAHGIPVGSD
LEYADAMTLNKALEGRGEFG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttgtactactccgggccggtggccaggctggtagatgaatttgccaagctgccggga
attgggcccaagactgcccaaagactggcctttcatgttttaaattcaccgccggagctg
gcacaggggctggcgaaagccctagttgaagtgaggcaatcaataaaacgctgttccctt
tgttgtaatctaacagatgaagacccctgttctatctgtcaggataccaccagaaacagt
aacttgctatgtgtagtggaggaaccaagggatgtcattgccatggaaaaagcccgaggg
tatcgggggtattatcatgttctgcacggagcaatttcaccaatggaagggatacgtcca
gaggacttaaccataaaggaacttctacatcgtttacagaatggtgatatacaggaggtt
attttagcagccaattcggatgtggaaggagaaaccacagccctttacttggctagacta
ttaaaacctctgggtgtaaaagttactcgcattgcccatggcattcctgtgggctcggac
cttgaatatgccgatgccatgaccttgaataaggcattggagggccgtggtgaatttgga
taa

DBGET integrated database retrieval system