KEGG   Desulfotomaculum reducens: Dred_0044Help
Entry
Dred_0044         CDS       T00494                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
drm  Desulfotomaculum reducens
Pathway
drm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:drm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dred_0044
DNA repair and recombination proteins [BR:drm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Dred_0044
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dred_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 Cdd1 IMS_HHH HHH_3 HHH_8 Toprim_2
Motif
Other DBs
NCBI-ProteinID: ABO48594
JGI: dred0044
UniProt: A4J0J1
Position
54738..55340
Genome map
AA seq 200 aa AA seqDB search
MLYYSGPVARLVDEFAKLPGIGPKTAQRLAFHVLNSPPELAQGLAKALVEVRQSIKRCSL
CCNLTDEDPCSICQDTTRNSNLLCVVEEPRDVIAMEKARGYRGYYHVLHGAISPMEGIRP
EDLTIKELLHRLQNGDIQEVILAANSDVEGETTALYLARLLKPLGVKVTRIAHGIPVGSD
LEYADAMTLNKALEGRGEFG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttgtactactccgggccggtggccaggctggtagatgaatttgccaagctgccggga
attgggcccaagactgcccaaagactggcctttcatgttttaaattcaccgccggagctg
gcacaggggctggcgaaagccctagttgaagtgaggcaatcaataaaacgctgttccctt
tgttgtaatctaacagatgaagacccctgttctatctgtcaggataccaccagaaacagt
aacttgctatgtgtagtggaggaaccaagggatgtcattgccatggaaaaagcccgaggg
tatcgggggtattatcatgttctgcacggagcaatttcaccaatggaagggatacgtcca
gaggacttaaccataaaggaacttctacatcgtttacagaatggtgatatacaggaggtt
attttagcagccaattcggatgtggaaggagaaaccacagccctttacttggctagacta
ttaaaacctctgggtgtaaaagttactcgcattgcccatggcattcctgtgggctcggac
cttgaatatgccgatgccatgaccttgaataaggcattggagggccgtggtgaatttgga
taa

DBGET integrated database retrieval system