KEGG   Desulfotomaculum reducens: Dred_0134Help
Entry
Dred_0134         CDS       T00494                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00010  Glycolysis / Gluconeogenesis
drm00051  Fructose and mannose metabolism
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
drm01200  Carbon metabolism
drm01230  Biosynthesis of amino acids
Module
drm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
drm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dred_0134
   00051 Fructose and mannose metabolism
    Dred_0134
   00562 Inositol phosphate metabolism
    Dred_0134
Enzymes [BR:drm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dred_0134
Exosome [BR:drm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dred_0134
  Exosomal proteins of bladder cancer cells
   Dred_0134
  Exosomal proteins of melanoma cells
   Dred_0134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABO48684
JGI: dred0134
UniProt: A4J0T1
Position
141264..142016
Genome map
AA seq 250 aa AA seqDB search
MRQLIIVGNWKMHKTVTETLEFLVELKEKLSNTAVEVVVSPPFTALAAAAEVLKGSPIAL
AAQNMHWKKQGAFTGEISSAMLKELGCKYVILGHSERRQYFSETDDHVNKKVKSALESEL
IPIVCVGESLEQRETGATEATVEKQINGALAGLSPEQAAGIVIAYEPVWAIGTGKTASDE
DAQQVNGYIRKVIACRFGNTVAEAVRIQYGGSVKPANAQGLMAQPDIDGALVGGASLKMH
DFVGIIQNVL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagttaattatcgttggaaactggaagatgcacaaaaccgtaacggaaacattg
gagtttttagtagaactaaaagagaaattaagcaataccgcggttgaagtggtggtaagc
cctccctttaccgccctggcggcggctgctgaagtcttaaagggcagccccattgcttta
gctgcccagaatatgcattggaaaaaacaaggggcttttactggggaaatttcctcggcc
atgcttaaggaattaggttgcaaatatgttatactcggccattcggagagaaggcaatat
tttagcgaaacggatgaccatgttaataaaaaggtaaagtctgccctagagagtgaatta
attcccattgtttgtgtaggggaaagtctggagcaacgggaaaccggtgccaccgaggcc
acagtggaaaaacagatcaacggggctctcgctggcctgagtccagaacaggcagcaggt
attgtcattgcctatgaacctgtgtgggccattggtacaggtaaaacggcctccgacgaa
gatgctcagcaagtaaacggctacatacgcaaggtgattgcctgccgctttggcaacact
gttgctgaagcggttcgcattcagtacggaggtagtgtcaagcctgccaatgcccagggt
ctcatggctcaaccggatatcgatggagctttggtgggtggtgccagtttgaaaatgcat
gattttgtcggcatcattcaaaatgttctttaa

DBGET integrated database retrieval system