KEGG   Desulfotomaculum reducens: Dred_0156Help
Entry
Dred_0156         CDS       T00494                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
drm  Desulfotomaculum reducens
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dred_0156
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dred_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
165684..166166
Genome map
AA seq 160 aa AA seqDB search
MTVAYIGLGSNMGDKKAYIQSALKKLDHYTGIHLLRVASLYESAPWGYLEQDWFVNTVAE
VETTLSPEKILQVLFDIERSLNRTRDIHWGPRTVDLDLLLYGSQTICFPHLQVPHPRMHE
RAFVLVPLAELCPNMILTQGTVMELAEKTLAEQAIRKIES
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggcatatattggcctaggaagcaacatgggtgataaaaaagcctatattcaa
agtgccctaaagaaattggaccattatacagggattcatttgcttagggttgcatccctt
tacgagagtgccccctggggttatttggagcaggattggtttgtcaatactgtggcagaa
gtggaaacaaccctttcacccgaaaaaatattacaggtgctgtttgatattgaaaggagt
ctgaacagaaccagggatattcattggggacccaggacagtggatctggatttattactt
tacggtagtcaaacaatttgttttccccatttgcaagtaccacacccccgtatgcatgaa
agggcctttgtactggttcccctggcagagctatgcccgaatatgattttaacacaagga
actgtgatggagttagcagagaagacattagcggagcaggcaatcagaaagatagaaagc
taa

DBGET integrated database retrieval system