KEGG   Desulfotomaculum reducens: Dred_0251Help
Entry
Dred_0251         CDS       T00494                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01130  Biosynthesis of antibiotics
drm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dred_0251
Enzymes [BR:drm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dred_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth NanE FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: ABO48800
JGI: dred0251
UniProt: A4J147
Position
252780..253577
Genome map
AA seq 265 aa AA seqDB search
MILEKIKEKKREEIRQLLLTANVAHMKKKILELPPARDFRKALYNQGQVSLIAEIKKASP
SKGLLCPNFDHRQLAHIYQSNGAAALSVLTDENFFLGKLTYLEEIKQQSSLPLLRKDFIL
DPVQLYQSRLAGADAVLLIAGLLTPGELSQLFLLCREIGMQALVEVHTQEELQRVLTTDA
KLIGINNRDLSTFQTNLATTAKLLEQVQIEDITIVSESGIAQKEDIKFLKSLGVHGVLVG
EALVTAQDIAKKVQEIVVAGGRGEA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgattctggaaaaaattaaagaaaagaaaagagaagaaattcggcaactacttcttact
gccaatgtagcccacatgaaaaagaaaattttggagttacccccagccagagattttcga
aaggccctttataatcagggacaggtaagcctcattgcagaaattaagaaggcctcccct
tcaaaggggctgctttgcccaaactttgatcatcgccaactggcccatatataccagtcc
aatggagctgcagcgttatcagttttaacagatgagaactttttcttaggaaaattgact
tatctggaggaaataaagcaacaaagcagcctaccccttctaaggaaagattttattctt
gaccctgtgcagctttatcaaagccgactggctggagcagatgcagttttattaattgcc
gggctgcttacccccggcgagcttagtcaattatttttgttatgccgagaaattggtatg
caagcattggtggaagtacatacccaagaggaattacaacgggtactgactacggatgca
aagttgattggcattaataatcgggatctctccacctttcaaaccaatttggcaaccacc
gcaaaactgctggagcaggtacaaatagaggatattaccattgtcagtgaaagtggtatt
gcccaaaaagaggatataaaatttctaaaatccctgggggttcatggggttctggtggga
gaagctctggtaaccgcccaggatattgctaaaaaggtgcaggaaattgttgtggcaggc
ggaaggggtgaagcttga

DBGET integrated database retrieval system