KEGG   Desulfotomaculum reducens: Dred_0253Help
Entry
Dred_0253         CDS       T00494                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_0253
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dred_0253
Enzymes [BR:drm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dred_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
254189..255379
Genome map
AA seq 396 aa AA seqDB search
MQPDHRGYFGPYGGAFVPETLMPALEELIQAYGAASEDEEFLKEVTYYLNDYVGRPSPIY
FARALSEGTGGAKIFLKREDLNHTGAHKINNTIGQLLLARRMGKKRIVAETGAGQHGVAT
ATVSAMLGMQCVVYMGEEDIRRQALNVFRMRLLGAEVVKVSSGTGTLKDAMNEAMRDWVT
NVRNTFYVIGSVAGPHPYPKMVRDFQSIIGREAREQMLKKTGRLPDYVVACVGGGSNSMG
IFYPFLEDQEVHLVGVEAGGLGLSSGQHAAPLTVGRPGVLHGSYSYLMQDSHGQVHSVYS
ISAGLDYPGVGPEHSYLRDAGRVRYTVATDKEALEAFHLLCRTEGILPALESSHALVEAV
KLAKVLDNSHNILVCLSGRGDKDVHTVAEGMGEELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccggatcatagaggttattttggcccttacggtggtgccttcgtgccagaaaca
ctgatgcctgcactggaagaactaatccaggcttacggggcagccagtgaggatgaagaa
tttttaaaggaggtaacatattatttaaatgattatgtaggacggccatctcctatttat
tttgcccgtgccctcagtgaggggaccgggggagccaagatttttctgaagagagaggat
ctaaatcataccggcgcccataaaattaacaataccatcggacaactgctgctggcccgg
cggatgggtaaaaaacgaatcgtagcagaaaccggggcggggcagcatggtgtggccacc
gctacggtttctgccatgctgggtatgcaatgtgttgtctatatgggtgaagaagacatc
cgacgccaggcccttaatgtatttcgtatgcgcttactgggggcagaggtggttaaggtc
agttctggtactggaacattaaaggatgctatgaatgaagccatgagggactgggttaca
aatgtaaggaatactttctatgtgattggttcggtggcgggaccacacccttatcctaaa
atggtaagggacttccaatccattattggtcgagaagcccgggaacaaatgctcaaaaaa
accggcagactgcctgattatgtggtggcctgtgtaggtggcggtagtaattccatgggt
attttttatccattcttagaagatcaagaagtccatttagttggggtagaagcagggggg
ctggggttgtcttccgggcaacatgcagcccctctcacagttggacggcctggggttttg
catggctcctatagttatttaatgcaggactcccacggccaagttcactcggtttattcc
atatcggcggggctggattatccgggggttggtccggagcacagctacctaagggatgct
gggagagtccgctacacggtggccaccgataaagaagccctggaggccttccatttactt
tgccgaaccgaaggaatcctgccagccctggagagttcccatgcactggtggaggccgta
aaattagccaaggtactggacaatagccacaacattctggtttgtttatctgggcgagga
gataaagatgttcatacagttgccgagggaatgggggaagaactggtatga

DBGET integrated database retrieval system