KEGG   Desulfotomaculum reducens: Dred_0253Help
Entry
Dred_0253         CDS       T00494                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:drm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:drm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:drm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
254189..255379
Genome map
AA seq 396 aa AA seqDB search
MQPDHRGYFGPYGGAFVPETLMPALEELIQAYGAASEDEEFLKEVTYYLNDYVGRPSPIY
FARALSEGTGGAKIFLKREDLNHTGAHKINNTIGQLLLARRMGKKRIVAETGAGQHGVAT
ATVSAMLGMQCVVYMGEEDIRRQALNVFRMRLLGAEVVKVSSGTGTLKDAMNEAMRDWVT
NVRNTFYVIGSVAGPHPYPKMVRDFQSIIGREAREQMLKKTGRLPDYVVACVGGGSNSMG
IFYPFLEDQEVHLVGVEAGGLGLSSGQHAAPLTVGRPGVLHGSYSYLMQDSHGQVHSVYS
ISAGLDYPGVGPEHSYLRDAGRVRYTVATDKEALEAFHLLCRTEGILPALESSHALVEAV
KLAKVLDNSHNILVCLSGRGDKDVHTVAEGMGEELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccggatcatagaggttattttggcccttacggtggtgccttcgtgccagaaaca
ctgatgcctgcactggaagaactaatccaggcttacggggcagccagtgaggatgaagaa
tttttaaaggaggtaacatattatttaaatgattatgtaggacggccatctcctatttat
tttgcccgtgccctcagtgaggggaccgggggagccaagatttttctgaagagagaggat
ctaaatcataccggcgcccataaaattaacaataccatcggacaactgctgctggcccgg
cggatgggtaaaaaacgaatcgtagcagaaaccggggcggggcagcatggtgtggccacc
gctacggtttctgccatgctgggtatgcaatgtgttgtctatatgggtgaagaagacatc
cgacgccaggcccttaatgtatttcgtatgcgcttactgggggcagaggtggttaaggtc
agttctggtactggaacattaaaggatgctatgaatgaagccatgagggactgggttaca
aatgtaaggaatactttctatgtgattggttcggtggcgggaccacacccttatcctaaa
atggtaagggacttccaatccattattggtcgagaagcccgggaacaaatgctcaaaaaa
accggcagactgcctgattatgtggtggcctgtgtaggtggcggtagtaattccatgggt
attttttatccattcttagaagatcaagaagtccatttagttggggtagaagcagggggg
ctggggttgtcttccgggcaacatgcagcccctctcacagttggacggcctggggttttg
catggctcctatagttatttaatgcaggactcccacggccaagttcactcggtttattcc
atatcggcggggctggattatccgggggttggtccggagcacagctacctaagggatgct
gggagagtccgctacacggtggccaccgataaagaagccctggaggccttccatttactt
tgccgaaccgaaggaatcctgccagccctggagagttcccatgcactggtggaggccgta
aaattagccaaggtactggacaatagccacaacattctggtttgtttatctgggcgagga
gataaagatgttcatacagttgccgagggaatgggggaagaactggtatga

DBGET integrated database retrieval system