KEGG   Desulfotomaculum reducens: Dred_0413Help
Entry
Dred_0413         CDS       T00494                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
drm  Desulfotomaculum reducens
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:drm00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
454986..455990
Genome map
AA seq 334 aa AA seqDB search
MNLAKFTRRRYTEGQTPIEFLPNFTKALGGPNIYIKRDDQLGLTSGGNKTRKLEFLVADA
LAQGADTLITCGAVQSNHCRLTLAAAVKEGLKCRLVLEERVPGSYKPEASGNNFLFNLLG
VEKVKVVSGGSDMMKEMQIVADELAAEGRKAYIIPGGGSNEIGSLGYVACAQEISAQLFE
KGLKIDHIVTPSGSAGTHTGLVTGFYGNNCNIPITGISVSRKKHEQEELVYSVIQKTAAL
LEIKQEIPREAVSVYDDYVGPGYSLPTPEMVEAVQLLARTEGILLDPVYTGKAMSGLIGL
VRKGFFKKDQNVLFIHTGGSPALYAYTSTILGND
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagcaaaatttactcggagacgttacacagagggacaaacaccaattgagttt
ttacctaattttacaaaggctctagggggacccaacatctatattaaaagggatgaccaa
ctaggattaacttctgggggtaataaaaccagaaagttggaattcttagtggcagatgct
ctggcacagggggctgatacccttattacctgcggagcagtacagtccaaccattgtcga
cttaccctcgcggcagctgtgaaggaaggtttgaaatgcagattagttttagaagaaagg
gttcccggtagctataagccagaagccagcggaaacaactttttgtttaatctgctgggt
gtagaaaaagttaaggttgtatcaggcggttcagatatgatgaaggaaatgcaaattgtt
gccgacgaattggccgccgaggggcgtaaggcctatataatccccggtggtggttcaaac
gaaataggcagtttaggctatgttgcatgtgcacaggaaatttccgcccaactttttgaa
aaaggtttaaagattgatcatattgttactcccagtggtagtgcaggaactcataccggg
ttggtaacaggattttacggtaacaactgtaatattccgataactgggattagcgttagc
cgtaaaaaacacgaacaagaagaattggtgtacagcgtaattcaaaaaactgccgccctt
ttagagataaaacaagaaatcccgagggaagctgtaagtgtatacgatgattatgttggc
cctggttattccttgcctactccggaaatggttgaagcggtacaactattggccagaaca
gaaggtattttgcttgaccctgtatacactggtaaagcaatgtctggcttaataggactt
gttcgtaagggctttttcaagaaagaccagaatgtcctattcatccatactggtggttct
cctgcgttatatgcttatacgtcaactatcctgggcaacgattaa

DBGET integrated database retrieval system