KEGG   Desulfotomaculum reducens: Dred_0515Help
Entry
Dred_0515         CDS       T00494                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
drm  Desulfotomaculum reducens
Brite
Enzymes [BR:drm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Dred_0515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
555014..557647
Genome map
AA seq 877 aa AA seqDB search
MKIKFDSNQQYQLDAIQAIVDVFKGQPRSQGKFEVDLMGLSSGMFNELGVGNHLTPDEDT
ILANLKEIQEQNGIPQAEALDGMNFSVEMETGTGKTYVYLRTIHELYAQYGFTKFIIVVP
SVAIREGVLKNLSITKEHFQGIYGNQPFDYWVYDSKRVSSLRQFASSNQLQILVINIDAF
NKKENNVIHKENDRLSGRKPIEFIQATQPIVIVDEPQNMESTQAKEAIQSLNPLCTLRYS
ATHRHIYNLLYRLDPVKAYDMKLVKRIEVDSVLEEDNFNQPYIRVESIKATKTKITAKLT
IDCKQADGVKRTSVSISKNGTDLYELSGNRELYQGYIVDHIDAGSQYIAFTNGVVLNTGQ
QMGGYNDDIMKVQIRETVKEHLEKELHIYRNLPEGKRLKVLSLFFIDKVANYDDAEGKIR
LWFEEVYQELAFKPRYRELNLPPVEAVHSGYFAQSKGKAKDTSGKTKADDEAYQLIMKDK
ERLLSLEEPVRFIFSHSALREGWDNPNVFQICTLNETKSEMKKRQEIGRGLRLPVDQTGH
RVFDTTMNRLTVVANESYEDFARSLQTEIEEECGVQFEGRIDNKRQRRTANLKKGWRMDE
NFLALWDRIKYKTRYSVKYQTGHLIAQAAQAIKKMPAIESPKIMAQKRGLEITSKGLETR
MLSVQETKVGYSGLPVPDLLSYIQRETELTRSTIAQILINSERLADVAVNPQRFLEEATK
AIKETLHSIMIDGIQYERIDGAEYEMLLFADPKHEIRGYVNRMLEVKGSIYDAIEFDSEV
EKEFAQNLDARQDIKLFIKLPRWFTVETPLGTYNPDWAIVKQAVGEDEKLYLVSETKSTK
DLSKLRDSERDKIECGKRHFSALPEVQFKHVKDASEV
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaaatttgacagcaaccagcagtaccaactggatgccatccaagccatcgta
gatgtgttcaagggacaaccccgctcccagggcaaatttgaagtggacctaatgggtctc
tccagcggtatgtttaacgaactgggtgtggggaatcacctgaccccggatgaagatacc
atcctggcgaacctaaaagaaatccaggagcaaaacggcatcccccaggctgaagcattg
gacggcatgaacttctcggtggagatggagaccggcacagggaaaacctatgtttacctc
cgtaccattcatgaactttacgcccagtatggttttaccaagtttattatcgtagtgccc
agtgtggccattcgggaaggggtactcaagaacctgtccattaccaaagagcattttcag
ggcatttatggcaatcaaccctttgactactgggtgtatgattccaaaagggtatcgtcc
ttgcgtcagtttgccagttcaaatcaactacaaatattggttatcaatatcgatgccttc
aataaaaaagaaaataacgtcatccataaagaaaacgaccgactgtctggccgcaaaccc
attgaattcatccaggccacccagcccattgtcatcgtggatgaaccacaaaacatggaa
agcacccaggccaaagaggccatccaaagcctcaaccccctttgtaccctgcgctactcg
gccacccatcggcatatatacaacttgctttaccgtctggacccagtgaaggcctacgat
atgaagctggtgaaacgcattgaggtggattcggtactggaggaagataacttcaaccag
ccctacatccgggtggaatccatcaaggccaccaaaaccaagatcactgccaaactaacc
atcgactgcaagcaggccgatggcgttaagcggaccagtgtctccatcagcaagaatggc
acagatctgtacgaactctcaggtaaccgggaactttaccagggctacattgtagaccat
atcgatgcaggtagtcagtatatcgcctttaccaacggagtggttttaaataccggccaa
caaatgggcggttataacgacgatattatgaaggtgcaaattcgggaaacggtcaaggaa
cacctggagaaagaactccacatttacaggaatctgcccgagggaaaacgcttaaaggtg
ctatccctgtttttcattgacaaagtggccaattatgacgatgccgaaggcaaaatccgc
ctgtggtttgaggaagtgtatcaggaattagcctttaaaccccgctatcgagaactaaac
ttaccacctgtggaggcagtccatagtggttacttcgcccaaagtaagggcaaggccaaa
gataccagcgggaaaaccaaagcagatgacgaagcctaccagttgatcatgaaggataag
gaaaggttactctccctggaggaaccggtccggtttatcttcagccactcggccctacgg
gaaggttgggacaaccccaacgtattccaaatctgtaccttaaacgaaaccaaatccgag
atgaagaagcgacaagaaatcggccggggcttgcgattacctgtagatcaaaccggtcac
cgggtctttgataccaccatgaaccgtctcaccgtcgtcgccaacgaaagctacgaagac
tttgcccgttccctgcagactgaaatcgaagaggaatgtggtgtgcagtttgaaggtcgc
attgataataaaagacaacgccgtacagctaacctgaaaaagggctggcgcatggacgaa
aacttcctggctctctgggatcgcattaagtataaaaccaggtattcggtaaagtaccaa
acaggtcatctgatagcccaggctgcccaggccattaagaaaatgcccgctatcgaaagc
cccaaaatcatggcccaaaaacgggggctagagattaccagcaaaggcttggaaactcgt
atgttatcggtccaagaaaccaaagtcggctactccggcctgccggtaccggatttactt
agttacatccagcgggaaaccgaacttacccgcagcaccatcgctcaaatcctaatcaat
tcggaaaggctggcagacgtagcagtaaacccccaacgctttctggaggaagccaccaaa
gccattaaggaaaccctgcacagcatcatgatcgacggtatccaatacgaacgcattgac
ggcgcagaatatgagatgcttctctttgcagaccccaagcatgaaattcgcggctatgtc
aatcggatgctggaagtaaagggttccatttacgatgccatcgaattcgattccgaagtg
gaaaaggaatttgcccagaatttagacgcgcgacaggatatcaaactcttcattaaactc
ccacgctggtttacagtggaaacgcccctgggcacctataacccagactgggccatcgtc
aagcaggccgtaggagaagacgagaaactttacctagttagcgaaaccaaatctacgaag
gacttgtctaagctacgagacagtgaacgggataaaattgagtgtggtaagaggcacttc
agtgcactgccggaggttcagtttaagcatgtgaaagatgcttcggaggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system