KEGG   Desulfotomaculum reducens: Dred_0615Help
Entry
Dred_0615         CDS       T00494                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dred_0615
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_0615
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dred_0615
Enzymes [BR:drm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dred_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
659896..661107
Genome map
AA seq 403 aa AA seqDB search
MSYVSHLECAKCGKHYHSEEVRQLCPECSGPLVVRYDLEAVKENFHKEDLKDREPSLWRY
WELLPLKDRKNLVSLGEGMTPMIKMEKAGPAIGLNNLYLKDEGIIPSGTFKSRGATVGVS
RAKELGIKTLAMPTNGNAGASWSTYGARAGIKSVIVMPQDAPEITRNECAITGADLYLVD
GLISDAGKIVARAVQKYGWFDVSTLKEPYRIEGKKTMGLEIVEQFNWEVPDVILYPTGGG
VGIIGIYKALKELQAIGWIGEKMPRLVAVQAEGCAPIVKAWQEGKKESEFWNNAYTCAFG
ITVPKALGDFLVLDAIYKTNGCAIAIGDEDLLKAQAVLAAQEGAFVCPEGASLYTAAQKL
REQGWIKEDEKVVLLNTGTGLKYPETVKVNVPLLQPNDDIPEA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgtatctcatctggaatgcgccaaatgtggaaaacactatcacagtgaagaa
gttcgtcagctttgccctgagtgcagcggtccgctggttgttcgctatgacttggaggca
gtgaaggaaaatttccacaaggaagatttaaaggaccgtgagcccagcctctggcgttac
tgggaactgcttcccttaaaagacagaaagaatctggtatccctgggtgaaggcatgacc
cccatgattaaaatggagaaagcaggtcctgccattggtttaaacaacctgtacttgaag
gacgaaggaattatcccctctggtacctttaaatccagaggagccaccgttggggtatcc
agagcaaaggaactgggtattaaaaccctggctatgcccaccaatggtaacgcaggtgct
tcttggtccacctatggtgccagagctggcattaaatcggtaattgttatgcctcaggat
gctcctgaaattacccgtaacgagtgtgccattactggtgcggatctctacctggtggat
gggctgatcagtgatgctggtaaaattgtggcccgtgctgtgcaaaaatacggttggttt
gatgtttcgaccttaaaagagccctatcgtattgaaggtaaaaaaacgatgggtctagag
attgtagaacaattcaactgggaagttcctgatgttatcctttatcccactggcggtggt
gtagggatcatcggtatctacaaagccctaaaagaattacaggctatcggctggattgga
gaaaaaatgccccgtctggtagctgtacaggcggaaggttgtgcacccatagtaaaagca
tggcaagagggcaaaaaagaatccgaattctggaacaatgcttatacctgtgcctttggt
attactgtacccaaagctctgggtgacttcctagtactggatgccatctacaaaaccaat
ggttgcgccattgccatcggtgatgaagatcttcttaaggctcaggcagtactggcagca
caagaaggtgcctttgtttgccccgagggtgcttccttgtacactgcggcacaaaaactg
agagaacaaggctggataaaagaggacgagaaggttgttctgctgaacaccggtaccggt
ctaaaatatcctgaaactgttaaggtaaatgttcctttgttgcaacccaatgatgatatt
ccagaagcatag

DBGET integrated database retrieval system