KEGG   Desulfotomaculum reducens: Dred_1305Help
Entry
Dred_1305         CDS       T00494                                 

Definition
acetaldehyde dehydrogenase
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
drm  Desulfotomaculum reducens
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dred_1305
   00650 Butanoate metabolism
    Dred_1305
Enzymes [BR:drm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dred_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1395243..1396697
Genome map
AA seq 484 aa AA seqDB search
MLDFDLSSIQEARDLARKAKEAQKIFAKFSQEEVDRVVKAMVDAALANAEWLARMAVDET
KFGVFEDKVTKNRFASEGVYNYIKDMKTVGIINEDKEKRVVEIAAPVGVVMGIIPSTNPT
STTIYKSIISLKSRNAIVFSPHPSASRCIFAAAQIMHKAAVEAGAPAGIIGCLSKNTIAA
TNELMKHDDIAVILATGGSAMVKAAYSSGKPAYGVGPGNVPCFIEKSADIQYAVRCVMAS
KTFDNGTICASEQAIVVEECMKDKVVAELKAQGGYFMTPEEISKVAKFLFTPKGMNAALV
GKSAKFIAEKVGINIPEGTKVLIGEQTGVGKDYPLGREKLTAVLAFYCEKDWHAACERCI
QLLEYEGIGHSLAIHSNNDEIIREFALHKPVFRILVNTPSTLGGIGYTTGIAPALTLGCG
TWGGSSTSDNVTPRHLINIKRLAYPIREYEKVSQAEKIVKEECADQVSLEDIAQIVQKVL
AQLK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgctagacttcgacctcagttcgatacaagaggccagggatttggcccgtaaggctaaa
gaagctcaaaaaatctttgctaaatttagccaggaagaggttgacagagttgttaaagcc
atggtggatgcggctctggccaatgcagaatggctggccagaatggcagtggacgaaaca
aagtttggcgtatttgaagataaagtaaccaaaaatcgttttgcctccgaaggtgtatat
aactacatcaaggatatgaagacggttggcattattaatgaggacaaagagaagcgggtt
gttgagattgccgctcctgtgggtgtggtcatgggaattataccttccaccaacccaact
tccaccaccatatataaatcaattatctccctgaagtccagaaacgccattgtcttttcg
ccacacccttccgcttcacgttgtatttttgcggctgcccaaatcatgcacaaagccgcg
gtggaggcaggggcacccgccggaattattggttgtctatctaaaaataccattgctgcc
accaatgaattaatgaaacatgatgacatcgctgttattttggccacgggcggttctgct
atggtaaaggcagcctatagttccggtaaaccggcctatggcgtgggccctggcaacgta
ccttgttttattgagaagtctgcggatattcaatacgcagttcgatgcgtcatggccagt
aagacctttgacaacgggaccatttgtgcttcggaacaagccattgtagtagaagagtgt
atgaaagataaggttgtggctgaactaaaagcccagggcggctatttcatgaccccggaa
gagattagtaaagtagccaagtttctatttacccccaagggtatgaatgcggctttagtt
ggtaaaagcgccaagttcatcgccgaaaaggtaggaattaacattcctgagggcactaaa
gtattaattggcgagcagacaggtgtgggcaaagactatccgctgggccgtgagaagctg
actgctgtgctagccttttactgtgagaaggattggcacgctgcctgtgaacggtgcatt
caacttcttgaatatgaaggcattggtcatagcctggcgattcattctaataacgatgaa
attatccgtgaatttgctttacacaaacctgtatttagaatacttgtcaacacaccctct
accctaggtggtatcggttataccaccgggatagcaccagccctgactttgggctgcggt
acttggggcggcagcagtacttctgacaatgtaactcccagacacctgatcaatattaaa
cgtctggcatatcccatccgggaatatgaaaaggtgtcccaggcggaaaagatcgtaaag
gaagaatgtgcggatcaagtttcactggaggacatcgcccaaattgtgcaaaaggtgctg
gcacagttgaaatag

DBGET integrated database retrieval system