KEGG   Desulfotomaculum reducens: Dred_1361Help
Entry
Dred_1361         CDS       T00494                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00260  Glycine, serine and threonine metabolism
drm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01130  Biosynthesis of antibiotics
drm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_1361
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dred_1361
Enzymes [BR:drm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dred_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP VapB_antitoxin
Motif
Other DBs
NCBI-ProteinID: ABO49894
JGI: dred1361
UniProt: A4J491
Position
complement(1461346..1462521)
Genome map
AA seq 391 aa AA seqDB search
MSNLTGFYGEFGGAFVPDSLRKVLGDLEVAFMRYKDDPDFISELTYYLQQYVGRPNPLYF
AERLTKKLGGAKIYLKREDLNHTGSHKINNVLGQVLLAKRMGIKRVIAETGAGQHGVATA
TACAMFNMECVIYMGEEDTKRQALNVFRMELLGAKVVTVTTGTKTLKDAVDVALQDLVEN
HENTYYMLGSAVGPHPYPLIVRHFQSIIGIEAKDQLRKIEGRLPDYIMACVGGGSNAIGL
FYPFVEDKEVNIIGVEPGGKGLATGQHAAPLCAGKPGILHGFKCYLMQDENGEPLTTHSI
SAGLDYPGVGPEHSYLKATGRAEYVAINDTEALDAFKELSKTEGIIPALESAHAVAHAIK
IAPTLQQDQIIIVNISGRGDKDVEQVFYMLK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttaacaggcttctacggagaatttgggggggcctttgtcccggattcactt
agaaaagtattgggtgatcttgaagtagcttttatgcgctataaggatgaccctgatttt
atttccgaacttacttattatctgcaacaatatgttgggcgacctaacccgctttatttt
gcagaaagactgaccaaaaaactgggcggagccaaaatttaccttaaaagagaagatctt
aaccatactggctcacacaagatcaacaatgtacttggtcaggttttactggccaaaaga
atgggcattaaaagagttatcgccgaaaccggggctggtcagcacggagtagccacggct
acggcctgtgctatgtttaatatggaatgtgttatttatatgggtgaagaagataccaag
cgtcaggcactaaatgtttttcgtatggaattgctaggtgctaaagtagtaacagtaact
acaggcacaaaaacccttaaagatgctgttgatgtggctttacaagatctggtagagaac
cacgaaaatacttattatatgttaggttctgccgtaggtccccatccttaccctctaatt
gttcgacattttcagtcgataattggcatagaagcgaaggaccaacttcgaaaaattgaa
ggacgcttaccggactatataatggcctgtgttggcggcggtagtaatgccattggtttg
ttttatccctttgtggaggataaagaagttaatattattggcgtagaaccaggcggtaaa
ggtctggcaacaggtcaacatgccgcacccttatgtgcaggaaaaccaggaattttacat
ggctttaaatgctacttaatgcaggatgaaaatggggaaccattaacaacgcattcaata
tccgctggattagattaccctggtgttgggccggaacacagttatttaaaggctacgggc
agggccgagtatgtagccattaatgacaccgaagcattagatgcctttaaagaattatct
aaaacagagggtattataccggcacttgaaagtgcccatgctgtggcccatgccattaaa
atcgctcctaccctgcaacaagatcaaattatcatcgttaacatctccggacgtggggat
aaggatgtggagcaagttttttacatgttaaaataa

DBGET integrated database retrieval system