KEGG   Desulfotomaculum reducens: Dred_1361Help
Entry
Dred_1361         CDS       T00494                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dred_1361
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_1361
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dred_1361
Enzymes [BR:drm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dred_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1461346..1462521)
Genome map
AA seq 391 aa AA seqDB search
MSNLTGFYGEFGGAFVPDSLRKVLGDLEVAFMRYKDDPDFISELTYYLQQYVGRPNPLYF
AERLTKKLGGAKIYLKREDLNHTGSHKINNVLGQVLLAKRMGIKRVIAETGAGQHGVATA
TACAMFNMECVIYMGEEDTKRQALNVFRMELLGAKVVTVTTGTKTLKDAVDVALQDLVEN
HENTYYMLGSAVGPHPYPLIVRHFQSIIGIEAKDQLRKIEGRLPDYIMACVGGGSNAIGL
FYPFVEDKEVNIIGVEPGGKGLATGQHAAPLCAGKPGILHGFKCYLMQDENGEPLTTHSI
SAGLDYPGVGPEHSYLKATGRAEYVAINDTEALDAFKELSKTEGIIPALESAHAVAHAIK
IAPTLQQDQIIIVNISGRGDKDVEQVFYMLK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttaacaggcttctacggagaatttgggggggcctttgtcccggattcactt
agaaaagtattgggtgatcttgaagtagcttttatgcgctataaggatgaccctgatttt
atttccgaacttacttattatctgcaacaatatgttgggcgacctaacccgctttatttt
gcagaaagactgaccaaaaaactgggcggagccaaaatttaccttaaaagagaagatctt
aaccatactggctcacacaagatcaacaatgtacttggtcaggttttactggccaaaaga
atgggcattaaaagagttatcgccgaaaccggggctggtcagcacggagtagccacggct
acggcctgtgctatgtttaatatggaatgtgttatttatatgggtgaagaagataccaag
cgtcaggcactaaatgtttttcgtatggaattgctaggtgctaaagtagtaacagtaact
acaggcacaaaaacccttaaagatgctgttgatgtggctttacaagatctggtagagaac
cacgaaaatacttattatatgttaggttctgccgtaggtccccatccttaccctctaatt
gttcgacattttcagtcgataattggcatagaagcgaaggaccaacttcgaaaaattgaa
ggacgcttaccggactatataatggcctgtgttggcggcggtagtaatgccattggtttg
ttttatccctttgtggaggataaagaagttaatattattggcgtagaaccaggcggtaaa
ggtctggcaacaggtcaacatgccgcacccttatgtgcaggaaaaccaggaattttacat
ggctttaaatgctacttaatgcaggatgaaaatggggaaccattaacaacgcattcaata
tccgctggattagattaccctggtgttgggccggaacacagttatttaaaggctacgggc
agggccgagtatgtagccattaatgacaccgaagcattagatgcctttaaagaattatct
aaaacagagggtattataccggcacttgaaagtgcccatgctgtggcccatgccattaaa
atcgctcctaccctgcaacaagatcaaattatcatcgttaacatctccggacgtggggat
aaggatgtggagcaagttttttacatgttaaaataa

DBGET integrated database retrieval system