KEGG   Desulfotomaculum reducens: Dred_1379Help
Entry
Dred_1379         CDS       T00494                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00260  Glycine, serine and threonine metabolism
drm00750  Vitamin B6 metabolism
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01230  Biosynthesis of amino acids
Module
drm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_1379
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dred_1379
Enzymes [BR:drm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dred_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Ntox44
Motif
Other DBs
NCBI-ProteinID: ABO49909
JGI: dred1379
UniProt: A4J4A6
Position
complement(1482890..1484389)
Genome map
AA seq 499 aa AA seqDB search
MRYESTRGHSPVVSSAEAITKGIAPDGGLYVPTEKVSIDLSKIEALSSLSYPERATFVLK
HFLTDFSDDELIQCVDAAYGNSNFSSPDVAPVKPLTDNTAILELWHGPTCAFKDMALQIL
PQFLVRSLTKTGEASEIVILVATSGDTGKAALEGFANVPGTSIIVFFPQQGVSEVQRLQM
LTQEGKNVYVVGVKGNFDDAQTGVKKVFSDQEFAALLANKGFRLSSANSINWGRLVPQIV
YYFSAYADIVKNGTVKNGESINFVVPTGNFGNILAGYYAKSMGLPVNRLICASNTNNVLT
DFIRTGTYNRKREFFKTNSPSMDILISSNLERLLYELTGKQSDKINEWMTQLKSTGIYRV
DSDLLDLIQQHFWSDYATDEETLDTIHKVWLDHNYLMDTHTAVAMNVLEKYRAATGDNTY
SVVASTASPFKFNGSVTKAILGEKAVSGKSEFALLNDLASFTNWSIPVGLRNLDKRPVLH
QRLTNKDEIGNSVKNILIG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgaaagcacacgaggtcactctcctgttgtttcatccgctgaagcaataaca
aaaggtatagcccctgacgggggattatatgtaccaactgagaaggtatcaatagatcta
agtaaaattgaagccctaagttctttatcctatcctgaaagggctaccttcgtattaaaa
cattttctgacagactttagtgacgacgaattaattcagtgtgttgatgcagcctatggc
aatagtaatttttcctcaccggatgttgcccctgttaaaccacttactgacaacacagcg
attttggaactctggcacggtcccacctgtgcctttaaagacatggccttgcaaattctg
ccccaatttttagtgagatcccttacaaagaccggtgaagcatctgaaattgttatactt
gtagccacctccggggacacaggtaaagcagctttggaaggttttgcaaatgttcctggt
acaagcattatagtatttttcccacaacaaggagttagtgaagtacaaaggctgcagatg
ctaactcaggaaggtaaaaatgtgtatgtagttggggttaagggtaattttgatgatgcc
caaaccggggttaagaaggtatttagcgaccaggaatttgcagctttactggctaacaag
ggtttccgtttatcttcggccaactccataaactggggtcgtctggtccctcagattgtt
tactacttctccgcctatgcggatattgtaaaaaatggtactgttaaaaatggtgagtcc
atcaactttgtggtgcctacaggaaactttggcaacatcctggcaggctattatgctaaa
agtatgggcctaccagtaaatcgcttgatttgtgcatcaaataccaataacgtactaaca
gattttatccgaacaggtacctataaccgcaaacgagaatttttcaaaaccaactcacct
tctatggatattttaatctccagtaatctggaacgactgctgtacgaattaaccggcaaa
cagtctgataaaatcaatgaatggatgacgcaattgaagagtaccggcatctatagggtt
gactctgatttgctggacctaatccaacaacatttctggtctgactatgccaccgatgaa
gaaacattagacaccattcacaaagtttggttagaccataattatttaatggacacccat
acagcagttgccatgaatgttctagaaaaatatcgagctgccacaggggataatacctat
tctgtggtggcttccacggctagcccttttaagtttaacggtagcgtaacaaaggctatt
cttggtgaaaaagcagtgtctggcaaaagtgagtttgcattattgaatgacttagcttcc
tttaccaactggtccatacctgtaggtctacggaatttggataagcgcccggtcctacac
caaaggttgaccaacaaggatgaaatcggtaactctgttaaaaatattttaattggttaa

DBGET integrated database retrieval system