KEGG   Desulfotomaculum reducens: Dred_1379Help
Entry
Dred_1379         CDS       T00494                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dred_1379
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dred_1379
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dred_1379
Enzymes [BR:drm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dred_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1482890..1484389)
Genome map
AA seq 499 aa AA seqDB search
MRYESTRGHSPVVSSAEAITKGIAPDGGLYVPTEKVSIDLSKIEALSSLSYPERATFVLK
HFLTDFSDDELIQCVDAAYGNSNFSSPDVAPVKPLTDNTAILELWHGPTCAFKDMALQIL
PQFLVRSLTKTGEASEIVILVATSGDTGKAALEGFANVPGTSIIVFFPQQGVSEVQRLQM
LTQEGKNVYVVGVKGNFDDAQTGVKKVFSDQEFAALLANKGFRLSSANSINWGRLVPQIV
YYFSAYADIVKNGTVKNGESINFVVPTGNFGNILAGYYAKSMGLPVNRLICASNTNNVLT
DFIRTGTYNRKREFFKTNSPSMDILISSNLERLLYELTGKQSDKINEWMTQLKSTGIYRV
DSDLLDLIQQHFWSDYATDEETLDTIHKVWLDHNYLMDTHTAVAMNVLEKYRAATGDNTY
SVVASTASPFKFNGSVTKAILGEKAVSGKSEFALLNDLASFTNWSIPVGLRNLDKRPVLH
QRLTNKDEIGNSVKNILIG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgaaagcacacgaggtcactctcctgttgtttcatccgctgaagcaataaca
aaaggtatagcccctgacgggggattatatgtaccaactgagaaggtatcaatagatcta
agtaaaattgaagccctaagttctttatcctatcctgaaagggctaccttcgtattaaaa
cattttctgacagactttagtgacgacgaattaattcagtgtgttgatgcagcctatggc
aatagtaatttttcctcaccggatgttgcccctgttaaaccacttactgacaacacagcg
attttggaactctggcacggtcccacctgtgcctttaaagacatggccttgcaaattctg
ccccaatttttagtgagatcccttacaaagaccggtgaagcatctgaaattgttatactt
gtagccacctccggggacacaggtaaagcagctttggaaggttttgcaaatgttcctggt
acaagcattatagtatttttcccacaacaaggagttagtgaagtacaaaggctgcagatg
ctaactcaggaaggtaaaaatgtgtatgtagttggggttaagggtaattttgatgatgcc
caaaccggggttaagaaggtatttagcgaccaggaatttgcagctttactggctaacaag
ggtttccgtttatcttcggccaactccataaactggggtcgtctggtccctcagattgtt
tactacttctccgcctatgcggatattgtaaaaaatggtactgttaaaaatggtgagtcc
atcaactttgtggtgcctacaggaaactttggcaacatcctggcaggctattatgctaaa
agtatgggcctaccagtaaatcgcttgatttgtgcatcaaataccaataacgtactaaca
gattttatccgaacaggtacctataaccgcaaacgagaatttttcaaaaccaactcacct
tctatggatattttaatctccagtaatctggaacgactgctgtacgaattaaccggcaaa
cagtctgataaaatcaatgaatggatgacgcaattgaagagtaccggcatctatagggtt
gactctgatttgctggacctaatccaacaacatttctggtctgactatgccaccgatgaa
gaaacattagacaccattcacaaagtttggttagaccataattatttaatggacacccat
acagcagttgccatgaatgttctagaaaaatatcgagctgccacaggggataatacctat
tctgtggtggcttccacggctagcccttttaagtttaacggtagcgtaacaaaggctatt
cttggtgaaaaagcagtgtctggcaaaagtgagtttgcattattgaatgacttagcttcc
tttaccaactggtccatacctgtaggtctacggaatttggataagcgcccggtcctacac
caaaggttgaccaacaaggatgaaatcggtaactctgttaaaaatattttaattggttaa

DBGET integrated database retrieval system