KEGG   Desulfotomaculum reducens: Dred_1398Help
Entry
Dred_1398         CDS       T00494                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00010  Glycolysis / Gluconeogenesis
drm00030  Pentose phosphate pathway
drm00051  Fructose and mannose metabolism
drm00052  Galactose metabolism
drm00230  Purine metabolism
drm00500  Starch and sucrose metabolism
drm00520  Amino sugar and nucleotide sugar metabolism
drm00521  Streptomycin biosynthesis
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01120  Microbial metabolism in diverse environments
drm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dred_1398
   00030 Pentose phosphate pathway
    Dred_1398
   00051 Fructose and mannose metabolism
    Dred_1398
   00052 Galactose metabolism
    Dred_1398
   00500 Starch and sucrose metabolism
    Dred_1398
   00520 Amino sugar and nucleotide sugar metabolism
    Dred_1398
  Nucleotide metabolism
   00230 Purine metabolism
    Dred_1398
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dred_1398
Enzymes [BR:drm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dred_1398
    5.4.2.8  phosphomannomutase
     Dred_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABO49928
JGI: dred1398
UniProt: A4J4C5
Position
1507259..1508635
Genome map
AA seq 458 aa AA seqDB search
MSGLDGINFHIFREYDIRGKEQTDFTDEAVELLGLGLGTYFLQKGERDVVVCQDNRASSP
RLKTALNKGLLQTGCNVIDIGENPTPVCYFGLQHLSLTAGVMITGSHNPPEDNGFKISSA
GSTIFGKEIQRIKEIVVDGHFLSGLGQLTKYDIKEDYLKYLISRIHLYRPLKVVIDAGNG
TAGPLAVELFNRLGCEVIELYCESDSCFPNHHPDPTVPDNLRDLQQRVLQEKADVGLAFD
GDGDRLGVVDNLGKIIWGDILQILFWREILPQNPGTPVIVEVKCSQALVEEAKSLGGNPF
FYKTGHSLVKAKMKEVGALFTGEMSGHFFFADEYFGYDDALYAGARLLRLLSQSKKSLSQ
LLNNIPSYVSTPEIRLPFSDNYKKELIQRIKEKFVGEGYEVIDVDGARVIFPNGWGVLRY
SNTQPVVVMRAEAKDQASLGDIVNILKTTFVDTLERMK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggtttggatggtataaactttcatatctttcgtgagtatgatatcagggggaag
gaacaaacggattttaccgatgaggcggtggaattgctgggccttggcctaggtacctat
tttcttcaaaaaggggaaagggatgtggtggtctgtcaagacaaccgggccagttccccc
aggctaaaaacagccttaaacaaaggtctgttacagactggctgtaacgtcatagacatc
ggcgaaaacccgacaccggtatgctactttggattacagcacctgtcattaacagcaggg
gttatgattaccggcagtcacaatccgccagaggataacggttttaaaatttcttccgca
ggtagcaccatcttcggaaaagagatacaaaggattaaggaaattgttgtagatggccat
tttttatctggtttaggtcaactaactaaatatgatattaaagaagattatctaaagtat
ttaatttccagaatacacttataccgtcccctgaaagtagtaatagacgcgggtaacggc
actgccggtccgctggcagtggaattgtttaataggctgggctgtgaggtaattgagtta
tattgtgagtctgattcatgttttcccaaccatcatcctgatcctaccgttcccgataat
ttaagagatctgcagcaaagggttttacaggagaaggccgatgtgggcctggcctttgat
ggggatggtgaccggttgggggtggtggataacctggggaaaataatttggggagacatc
ttgcagattttattctggcgggagatattgccccaaaaccccggtacccccgtaatagtg
gaagtaaaatgcagccaggccctggtggaggaggccaaaagcttaggcggcaaccccttc
ttttataaaaccggccactcgttggttaaggccaaaatgaaagaagtaggtgctttattt
actggtgaaatgagcggtcacttcttttttgcggacgaatattttggctatgacgatgcc
ctttatgccggggctaggttgttaagactgctaagccaatccaagaaatctttaagccag
ctgttgaacaatataccttcctatgtttcaacgcctgagattcgattgcctttttcggat
aattataagaaggaattaatccaaaggattaaagaaaaatttgttggtgaaggttacgag
gtcattgatgtagatggagccagagttatctttcccaatggctggggggtacttcgatat
tcaaatacccagccagtggtggtaatgagggcagaggctaaagatcaagcctctttagga
gatattgttaacatattaaagacaacttttgttgatacattggagagaatgaaatga

DBGET integrated database retrieval system