KEGG   Desulfotomaculum reducens: Dred_1459Help
Entry
Dred_1459         CDS       T00494                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
drm  Desulfotomaculum reducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dred_1459
Enzymes [BR:drm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dred_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1587166..1588665
Genome map
AA seq 499 aa AA seqDB search
MTAKRASGILLHPTSLPSRYGIGDLGKEAYKFVDFLARSQQKLWQVLPLNPVGYGESPFQ
SYSAFAGNPLLISIDLLMENGLLTSQDVTEVPVFNQDQVEFQRVRDYKGSLLRKAFGNFK
KRNQPNGYCKFLAEKDWLADYALFMALKEYFSHQPWNQWEKSIALREVKSMEFFRILLKE
EIEYHYFLQYTFYSQWLSLKQYANSHGIGVIGDLPIFVSYDSSDAWANPHLFELDSLGKP
AKVSGVPPDYFSATGQLWGNPHYRWSEMEKDDYQWWRDRIKNLLQIVDVIRIDHFRGFES
YWEIPAGEKTAINGRWVKGPGEKFFAAIIKHLGKIPVIAEDLGIITPEVVELKERFNFPG
MKILHFNLHCNEKEDFLPHHYEKNSVVYTGTHDNDTTLGWYKKLLPGDAEFIKEYLKLET
PEEEDICWRLIEVAFKSKSNTAIIPLQDILCLDSGARMNYPGTVGGDNWAWRFRSHLLTS
EIETRLRELTAASGRGAFA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaaaaagggccagtggaatactcctacacccaacgtctctgccgtccaggtat
ggaatcggtgatttgggaaaagaggcctataaatttgtggattttctagccagaagccag
cagaagctctggcaggtacttcccctgaatccggtgggttacggagagtccccctttcag
agttattctgcctttgccggcaatccgctgttaatcagcatagacctactaatggaaaat
gggttattaacctcccaggatgttactgaagtaccagtttttaatcaggatcaagtggag
tttcaacgggtgagggactacaagggttctctgctcagaaaggcctttggtaattttaag
aaaaggaatcagcctaatggttactgtaaatttctagctgaaaaagattggctggcagat
tacgctttattcatggccctaaaggagtattttagtcatcagccctggaatcaatgggaa
aaatccattgccctaagggaagtcaagtccatggagttttttaggatactattgaaggaa
gaaatagaataccattacttccttcaatataccttttacagtcagtggctaagcctaaag
caatatgccaatagccatggtataggggtcattggagatttacccatctttgtttcctat
gacagcagtgatgcttgggccaatccccatttatttgaactggatagcttgggcaaaccg
gctaaggtgtcaggcgtaccaccggattattttagtgccacaggacaactttggggaaat
ccccattaccgttggtccgaaatggaaaaggatgattaccaatggtggcgggatagaatt
aaaaacttgttgcaaatagttgatgtgattcggattgaccattttaggggatttgagtcc
tattgggaaatccccgcaggtgaaaaaacagccattaatggcagatgggtaaagggacct
ggcgaaaaattttttgctgccatcattaaacatctgggaaaaatcccagttatcgccgag
gatttagggattatcacacccgaggtggtagaacttaaggagagatttaactttccgggt
atgaagatacttcattttaatttgcattgcaacgagaaggaagattttttaccccaccac
tacgagaagaattcggtggtgtacacaggcacccatgataacgatacaactctgggctgg
tacaaaaagttactgccgggggatgctgaatttataaaggagtatttaaaactagagact
cccgaagaggaagatatttgctggagacttattgaggtggcctttaagagtaaatccaat
acagccattatacctctgcaggatattctgtgcctggacagcggtgccagaatgaactat
ccaggcaccgttggtggagataactgggcctggcggttccggtcccatctattaacttcg
gagattgagacaaggcttagggagcttacggcagccagtgggagaggagcctttgcttga

DBGET integrated database retrieval system