KEGG   Desulfotomaculum reducens: Dred_1495Help
Entry
Dred_1495         CDS       T00494                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dred_1495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dred_1495
   00620 Pyruvate metabolism
    Dred_1495
   00650 Butanoate metabolism
    Dred_1495
  Lipid metabolism
   00071 Fatty acid degradation
    Dred_1495
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dred_1495
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dred_1495
   00626 Naphthalene degradation
    Dred_1495
Enzymes [BR:drm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dred_1495
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dred_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1619045..1621636
Genome map
AA seq 863 aa AA seqDB search
MSEQKPDQNISVTINGLVKKARQAQEEYLHLNQEQVDNIVKAMALAGLENHMGLAKMAVI
DTKRGVYEDKITKNIFATEEVYHSIKYERTVGIINENTEENFLEVAEPIGVVAAVVPVTN
PTSTTMFKALICAKTRNPVVFSFHPGALKCSIAAAKVMLEAAIAAGAPKDCISWIEKPSV
EATQQLMAHPGVSLILATGGTNMVCSAYSSGKPALGVGPGNVPCYIEKTANIRRAVTDLI
LSKTFDNGMICASEQAVIIDREIADLTIGYLRDSGCYILSPTEIEQLNKAAIDHDAGFID
PQIVGQPATHIAEMAGISVPSGTKILVAPLEGVGPEYPLSMEKLSPILALYIVNSSEEGI
QRCVDMLEFGGLGHSAVLHSENEELIKHFSQVVRAGRIIVNSPSTHGAIGDIYNTNVPSL
TLGCGSMGRNSTTANVSVKNLINVKRVATRKEKMQWFRVPERIYFMPGSIQYLTKMPDVQ
KVLIVTDKVMNDMGYVERVTYHLRKRQNDVQIEVFDLVEPDPPIEIVSQGVELMEKFNPD
TLIALGGGSSIDTAKGMWLLYEYPEMKFEFLKLKFLDIRKRTYKYPKLGRKVKLVAVPTT
SGSGSEITAFTVISDKQRKVKYPLADYELTPDVAIIDSDFVMSVPPKVTADTGIDVLTHA
IEAYVAVMASDYTDGLALKAIELVFAYLPRVYKNGQDKEARIKMHNASAIAGMAFTNAFL
GINHSMAHILGAKFGLSHGRANGVLLPYVIEYNASYPSKFAAFPNYEYYVAPEKYQQIAR
YLGLPSQTVEEGVHSLVGAIRNLMQQLDIPLTIADCGIPKAEFEAAVPEMSERAFEDQCT
TSNPRMPLIEELKEIYRRAYGNA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgaacaaaagcctgatcaaaatatctcggtcacaataaatggtttggtaaaaaaa
gccagacaggcccaggaagaatatctccatctaaatcaagagcaggtagacaatattgtg
aaagccatggccttagctggattggaaaatcatatggggctggctaagatggctgtgata
gatacaaagaggggtgtctacgaggataaaattacaaagaatatttttgccaccgaagag
gtttatcacagtattaaatatgagcgcactgtggggattatcaacgaaaataccgaggag
aattttttagaagtggcagaacccattggggtggtggctgccgtagttcctgtaaccaac
cctacctcaaccactatgtttaaagcattaatatgtgctaaaaccaggaatcctgtggtt
tttagttttcacccaggagctttaaaatgcagcatagcagcagcgaaagtgatgttagaa
gctgctatagctgcaggagcgccaaaggattgtattagttggattgaaaaaccctccgta
gaagcgacccagcagttgatggctcatcccggtgtatcccttattttagctaccggggga
acaaacatggtatgttcggcatacagttccggtaaaccagcccttggcgtgggtccgggc
aatgtaccctgttatattgagaaaactgctaacataagacgggcagtgacggatttaatc
ttaagtaaaacctttgataacgggatgatctgtgcttcggaacaggctgttattattgat
cgggagattgcggatcttaccattggctatctgagagacagtggttgttatattttatca
cccactgaaattgaacaattaaacaaagcagccattgatcatgatgctgggtttattgat
ccgcaaattgtagggcaaccggctacgcatattgcagaaatggctggaatttcagtaccc
agtggtacaaaaattttggtggctcccttggaaggagtaggaccagaatatcctctttct
atggaaaagctttcccccattttggctttatatatagtgaacagtagtgaagaagggatt
caaaggtgcgtagacatgcttgagtttggtggccttggtcattccgctgttcttcattcg
gagaatgaagaattaatcaagcatttttcgcaggtggttcgtgcaggacgtattattgta
aactcacccagtacccatggggccatcggagatatttataataccaatgtaccttcctta
acccttggttgtggctcgatggggcgtaactcaaccactgctaacgtcagtgtgaagaat
ctgattaacgtaaaaagggtagctacccgtaaagaaaaaatgcagtggtttcgggtgccg
gaacgcatttactttatgcccggatccattcagtatctgacaaaaatgccagatgttcaa
aaagtcttaatagttacagacaaggttatgaatgacatggggtatgtggagagggtgacc
taccatctgcgcaaacgtcaaaacgatgtccaaattgaggtctttgacttagtagaaccg
gatcctcccatagaaattgttagtcaaggcgtagaattgatggagaagtttaatccagat
acactgattgccctggggggcggatcctccattgatacagcaaagggcatgtggttgttg
tatgagtaccccgagatgaaatttgaatttcttaaactaaagtttctggacatccgcaaa
cggacgtacaaatatccaaaattgggccgcaaggttaagttggtggcagtaccaaccacc
agtggcagtggttctgagattacagccttcaccgtaatttctgacaagcaaaggaaagtc
aagtatcccctggcagattatgagcttacgccggatgttgctatcattgacagtgatttt
gttatgtccgttcccccgaaggttacggcggatactggtattgatgtgttaacccatgcc
attgaggcttacgtggctgtaatggcttcggattataccgatggtctggctttgaaagcc
attgaattggtctttgcgtacttgcccagagtttataagaatggtcaagacaaggaagca
agaattaagatgcacaatgcctctgccattgctgggatggcctttaccaatgcctttcta
gggattaaccatagcatggcccatatcctgggggctaagtttggcttatcgcatggccgg
gccaatggggtattgctcccttatgttattgaatacaacgccagctaccctagtaaattt
gctgcctttcccaattacgaatattatgtcgctcccgaaaagtatcaacaaatcgccaga
tatttggggctacccagtcagactgtagaagagggggttcatagcttggtgggggcaatc
cgtaatttaatgcagcagttggatataccattaactattgccgactgcgggattcccaag
gcagaatttgaggctgcagtaccagagatgtctgagcgagcctttgaggatcagtgtacc
acatctaatccacggatgcctttgatcgaagagctaaaagaaatctatcggcgagcctat
gggaatgcttag

DBGET integrated database retrieval system