KEGG   Desulfotomaculum reducens: Dred_1661Help
Entry
Dred_1661         CDS       T00494                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
drm  Desulfotomaculum reducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:drm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dred_1661
Enzymes [BR:drm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dred_1661
DNA repair and recombination proteins [BR:drm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dred_1661
    RecFOR pathway proteins
     Dred_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1818502..1819101
Genome map
AA seq 199 aa AA seqDB search
MIAYIKGLLAADGPGWVVIDVNGIGYHVSIPSTTQLPALGHEVKLFTHMSVREDGIQFFG
FAKEDEKECFLLLLNVAGVGPKVALAVVSHLPPSNLRSAIAIEDVNQLVKVPGVGKKTAQ
RILLELKDKLKGMAAVEHSTLQQSVITTGSGDEAVEALLALGYSQGEARDAVKKAQKSAP
EEDLSALIKIALKELAPSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgtatataaagggtttattagcagccgatgggccaggttgggtagttatagat
gtgaatggtatcggctatcatgtaagtataccatcaaccacccagttgcctgctctgggg
cacgaggttaagcttttcactcatatgagtgtaagggaagatggcattcagttctttggt
ttcgccaaggaagatgaaaaggaatgttttttgctattgctaaatgtggcgggcgtaggt
cccaaggtagctctggcagtagtgtcacatttgccgccaagcaacctaagatcggccata
gccatagaagatgttaatcaattggtgaaagtacccggtgtaggtaaaaaaactgcacaa
agaatattgctggaactgaaagataaactcaagggaatggcagcagtggagcatagtacg
ctacaacaatcggtcattaccacgggaagtggagacgaggctgtcgaggcgctgctggca
ctgggatattcccaaggagaagccagggatgcagtaaaaaaggcacaaaaaagtgcacca
gaagaggatttatctgccttgattaaaatagctctcaaagaactggcaccgtccaggtaa

DBGET integrated database retrieval system