KEGG   Desulfotomaculum reducens: Dred_1681Help
Entry
Dred_1681         CDS       T00494                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00240  Pyrimidine metabolism
drm00250  Alanine, aspartate and glutamate metabolism
drm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dred_1681
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dred_1681
Enzymes [BR:drm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dred_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-ProteinID: ABO50208
JGI: dred1681
UniProt: A4J555
Position
1834824..1835762
Genome map
AA seq 312 aa AA seqDB search
MFWQRKDLLGLRYLTPEEINLILDTAVPMKEIIGRKIKKTPTLRGRSMVTLFYENSTRTR
SSFDLAGKFLSADTVGLTASSSSVAKGESLRDTGLTLTAMGVDVVVMRHPASGAAEYLAK
CIPAAVINAGDGTHEHPTQALLDMFTIREKKGSMAGLKVVIVGDILHSRVARSNIWGLTK
MGAEVRVVGPITLMPKDIEKMGVKVYHRLEDALEGADVVNVLRIQLERQQQGLFPSLREY
SRLYGINQKRLELTASDAIILHPGPMNRGVEIEHQVAYGNRSFINEQVTNGVAVRMALLY
LLTGGEYHALSN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttttggcaaagaaaggatttactgggcctgaggtatttgacaccggaagaaatcaat
ttaattcttgatacagcagtcccaatgaaagaaatcatcggtcgtaaaattaaaaagacc
cctactctgcggggtaggagcatggtgaccctgttttatgagaatagcacaaggaccaga
tcctcctttgatttagcaggtaaatttcttagtgctgacacggtggggttaactgcttcc
agcagttctgtggctaagggagagagcctgcgagatacaggactaactttgacagccatg
ggtgttgatgtggtggttatgcggcatcctgccagtggtgctgcagaataccttgctaag
tgtattccggcggctgtgatcaacgctggggatggcactcacgagcatccaacccaggca
ttactggatatgtttaccatcagggaaaagaaaggcagcatggccggactaaaggtagtc
attgtaggagatatcctgcacagccgagtggctaggtccaatatttggggtttaacaaaa
atgggggctgaggtaagggtggtgggacccattaccttgatgcccaaggacatagagaaa
atgggcgttaaggtttatcaccgcctggaggatgccctggaaggggccgatgtagttaac
gtactgcgcatccagttagaaaggcaacagcaggggcttttcccctcccttcgggaatac
agcaggctctatggaattaaccaaaagagacttgaattaacggcttctgatgccatcatt
ctacacccgggacccatgaatcggggagttgaaatcgaacatcaagtggcctatgggaat
cgctcgttcataaatgagcaagtaacaaacggagtggcggtgcgtatggcgctgttatat
ctgttaacagggggtgaatatcatgcgttatctaattaa

DBGET integrated database retrieval system