KEGG   Desulfotomaculum reducens: Dred_1758Help
Entry
Dred_1758         CDS       T00494                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
drm  Desulfotomaculum reducens
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:drm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1921327..1921890
Genome map
AA seq 187 aa AA seqDB search
MFDLPKIEKAVKMILEAIGEDPNREGLEETPARVARMYQEIFAGLGEDPEEHLGKTFSEE
HEEMVIVKDIRLFSMCEHHLIPFIGKAHVCYIPRNGNVTGLSKLARLVNGYARRPQLQER
LTKQIADAIMKRLNPYGVVVVVEAEHLCMSMRGVRSPGARTVTSAVRGIFKKNEASRAEA
MSLIMKS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatctaccgaaaatcgaaaaagctgtgaaaatgattctagaagcaattggtgaa
gaccccaacagagaagggttagaggagacgccggccagggtggccagaatgtaccaagaa
atatttgctggtcttggggaagatccagaggagcacttaggaaaaaccttttccgaagaa
catgaggaaatggtaattgttaaagatatacgcttgttcagcatgtgtgagcaccatctt
ataccctttattggcaaagcccatgtatgttatattcctaggaatggaaatgtgacagga
ttatccaaactggcaaggttagtaaatgggtatgctcgtcgcccccaacttcaagaacgt
ctaaccaaacaaatagctgatgcaattatgaagcgtttaaacccctatggagttgtggtt
gtagtggaagcagagcatctttgtatgtccatgagaggtgtaagatcaccgggggccaga
acggtaacttctgcagtaaggggtattttcaaaaagaatgaagcctcccgtgctgaagcc
atgagcctaattatgaaaagttag

DBGET integrated database retrieval system