KEGG   Desulfotomaculum reducens: Dred_1970Help
Entry
Dred_1970         CDS       T00494                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00900  Terpenoid backbone biosynthesis
drm01100  Metabolic pathways
drm01110  Biosynthesis of secondary metabolites
drm01130  Biosynthesis of antibiotics
Module
drm_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dred_1970
Enzymes [BR:drm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Dred_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ABO50488
JGI: dred1970
UniProt: A4J5Y5
Position
complement(2165598..2166761)
Genome map
AA seq 387 aa AA seqDB search
MMKQISILGSTGSIGRQTLEVVNSFPEELNVVALAAGRNRELFLEQCKAYKPLLVSLQLE
EDALWLKEHLIKEKLRPEIRYGLDGLVAVATCHEAVVVVTALSGAIGLVPTCAAIKASKK
IALANKETLVAAGQYVTKLAEEYKVEILPVDSEHSAIWQCLHGENRSAIRKIQLTASGGP
FRQLNRQELENVTPEMALKHPNWSMGQKITIDSATLMNKGLEVIEAKWLFGVDYDDINVV
VHPQSVIHSMVEYGDGSLLAHLGMPDMRIPIQYALSYPERWFNHLPKLNLTELKGLTFEE
PDTNRFPSLSLAYQAGKIGGTAPAVLNAANEVAVHAFLAGQIKFMQIPSIVKRTLNEHQF
QGSPVLEEILEIDGWAREEANKIIRNC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacagatatctattttaggaagtaccggctcgattggcaggcagaccctggaa
gttgtaaatagtttcccggaagaacttaatgtggtagccttagctgcaggcagaaaccgt
gagttgtttttggaacaatgtaaagcctataaaccccttttagtttcccttcagttagaa
gaagatgctctttggcttaaagagcatctgataaaggagaagttaaggcctgaaattcgt
tatggtttagatggtctggtggcggtggccacttgtcatgaagcagttgtagttgtaacc
gcgctaagtggggccattggtttagttcccacctgtgctgccatcaaagcaagtaagaaa
attgcactggcaaacaaagaaactctggtggcagcgggacaatatgttactaaactggca
gaagaatataaggttgaaattttacctgtggatagtgaacattccgctatttggcagtgc
ttacatggggaaaatagatcagcgataagaaaaatccaactgacagcctctggtggtcct
tttcgccaattaaacagacaagaacttgaaaatgtcacgccagagatggccctgaaacat
cccaattggtccatgggacaaaaaatcaccatcgactccgctactttaatgaacaaagga
ttagaagttatagaagccaaatggctttttggtgttgactacgacgatattaatgtagtg
gttcatccccagagtgttattcattccatggttgaatatggcgatggttcattgcttgct
caccttggcatgccagatatgagaatacccattcaatatgcccttagttacccagaacgt
tggtttaaccatttacctaagttaaatctaacagaacttaaggggctaaccttcgaagaa
ccagatacaaataggtttccttccctgtcattggcttatcaggctgggaaaataggaggt
acagcaccggcagttttaaacgctgccaacgaagtagctgttcatgcatttctggcggga
caaataaaatttatgcaaattccctccattgttaaacgaactttaaacgaacatcaattt
caggggtctcctgtcctagaggagattcttgaaattgatggttgggcaagggaagaggca
aacaaaatcattagaaattgttag

DBGET integrated database retrieval system