KEGG   Desulfotomaculum reducens: Dred_2313Help
Entry
Dred_2313         CDS       T00494                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dred_2313
   01230 Biosynthesis of amino acids
    Dred_2313
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dred_2313
   00030 Pentose phosphate pathway
    Dred_2313
   00051 Fructose and mannose metabolism
    Dred_2313
   00052 Galactose metabolism
    Dred_2313
  Energy metabolism
   00680 Methane metabolism
    Dred_2313
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dred_2313
Protein phosphatases and associated proteins [BR:drm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dred_2313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2531081..2532043)
Genome map
AA seq 320 aa AA seqDB search
MQRIGLLTSGGDASGMNSSIRAVVRKAIYHGLEVIGIRRGYSGFIEADMGPMNLGSVADI
IGRGGTILHTARSERFKTKEGRALAMENIQRFGIQGLVVIGGDGSFTGASILHQEYGIPM
IGVPGTIDNDIAGTDYTIGFDTAVNTVVDAINKIRDTATSHERTFVIEVMGRNSGNIALA
AGLAGGAESILIPEIPFNIEEICQKLLRGIKRGKLHSIILVAEGAASGIDIGRQVKEQIG
FDTKVTILGHLQRGGTPTAFDRILAARLGAKAVELLMAGETNKMVGIKAGEIVATDLTEV
IGKPSPINKNMYELAKILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaataggcctattaaccagcggcggggatgcttcgggcatgaactcctcgata
cgtgcggtggttcgtaaagccatttaccatggcctggaggttattggtatccggcgtggc
tatagcgggtttattgaggctgatatgggtcccatgaatcttggctcagttgcagatatt
attggtcgagggggaaccattttacatactgcccgatccgaaaggtttaaaaccaaagaa
ggccgagccttggcaatggaaaacatacaacgctttggtatccaaggcttggtggttatt
ggtggggatggttcctttacaggggccagtattttgcaccaggaatatggcataccaatg
attggtgtacccggaaccattgataatgatattgctgggacggattataccattggtttt
gatacagctgttaacaccgtggtggatgccattaataaaattagagatactgcaacttcc
catgaacggacctttgtcattgaagtaatggggcgaaactcgggtaatattgccctagcg
gccggactggccggtggggcggaaagtatattaattccggagataccttttaatattgaa
gagatttgtcaaaaacttttaaggggcattaagagaggtaaacttcactcaatcattcta
gtagccgaaggtgctgccagtggaattgatattggtcgacaagtcaaagaacaaattggc
tttgataccaaagtaactatccttggacatttacagaggggtggtacgcctaccgccttt
gatcgtattctggcggctagattgggtgcaaaggcggtggaattgttgatggcgggagaa
accaataaaatggttggcattaaagccggtgaaattgtggccacagatttaaccgaagtc
attggaaaacccagccccattaataagaacatgtacgaattagcaaagatattatccata
tag

DBGET integrated database retrieval system