KEGG   Desulfotomaculum reducens: Dred_2315Help
Entry
Dred_2315         CDS       T00494                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
drm  Desulfotomaculum reducens
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dred_2315
   00640 Propanoate metabolism
    Dred_2315
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dred_2315
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dred_2315
Enzymes [BR:drm01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Dred_2315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2533084..2533950)
Genome map
AA seq 288 aa AA seqDB search
MVLEIFRKPKYVTVRPEKTETTQGNERRDIPEGLWVKCSRCNEILYTKELDKNFKVCHKC
NFHFRLNAQERIHMTLDEGSFQERDNELITLNPLNFPDYQEKIQSAQKATELKEAVVTGE
GTIGGNPVVIGVMDSHFIMGSMGSVVGEKIARAIERAIEKKLPVVLFSTSGGARMQEGIL
SLMQMAKTAAALAKLDEAGLLYVAVLTDPTTGGVTASFASLGDIIIAEPGALIGFTGPRV
IEQTIRQKLPEGFQRAEFLRKHGMVDMIVNRPQLKDTLANILSLHGTN
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggtcctagaaatatttcgcaaacctaaatatgtaactgtacgtcccgaaaaaacagaa
acgactcaaggcaacgaaagaagagacattccagaaggtttatgggtaaaatgttctcgc
tgcaatgaaattctttatacaaaggaattggataaaaattttaaggtatgtcataagtgc
aattttcattttaggttaaatgcgcaagagcgtattcatatgaccctagatgaaggttct
tttcaggaacgtgacaatgagttaattacattgaatccattgaattttccagattatcag
gaaaaaatacagtctgctcaaaaagcaactgaattgaaggaagccgtagtaaccggcgaa
ggtaccataggcggaaatcctgtggtcattggtgttatggactcgcattttattatgggt
agtatgggatctgtggttggagaaaaaattgcccgtgccattgaaagagccattgaaaag
aaattaccggtggttctgttttctacttccggtggtgccaggatgcaggagggaatttta
tctcttatgcaaatggcaaaaactgctgcagctttggctaaattagatgaagcgggatta
ttgtatgttgctgtccttactgaccccacaaccggcggagtaacagccagctttgcctct
ctgggagatattattatagcagaacccggagctttaattggttttaccggccctagggtt
attgagcaaaccattcggcaaaagttacccgagggcttccaaagggctgagtttttgcga
aagcatggtatggtcgatatgattgtgaatcgtccacagcttaaagataccctggctaac
attctttcacttcatgggacgaattaa

DBGET integrated database retrieval system