KEGG   Desulfotomaculum reducens: Dred_2439Help
Entry
Dred_2439         CDS       T00494                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
drm  Desulfotomaculum reducens
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:drm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dred_2439
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dred_2439
Enzymes [BR:drm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dred_2439
Two-component system [BR:drm02022]
 CheA family
  CheA-CheYBV
   Dred_2439
Bacterial motility proteins [BR:drm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dred_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2654850..2655959)
Genome map
AA seq 369 aa AA seqDB search
MLPVKVLVVDDSSLMRRLISRLLEEDKGIKVIGTAADGLEALQQIKALRPDVVTMDVEMP
RLDGIATLRRLMVDFPTPAVMLSAHTHEGARATMDALSAGAVDFVAKPTSSAELPRMVED
LKTKVKVAARVSLRRVRTTLTPPPAPLARPKPATTAAPGSAKAKPQTQVRRQPYCGKIDL
VVIGCSTGGPAALQQIIPYLPANLPAGVVVVQHIPVGFSKSMAEHLDKKSAISVRHAAEG
DAIKAGQVLVAPAGYDLNFKAKGNGSTVALSNQGAPLAPGGFRPSVDWVMKSAAEVYGCR
TLAVLLTGMGRDGARGMLAIKEQGGPTIAEHESTCVVYGMPKAAYDIGAAGKMVPLPQIA
QEIQAFFDV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggttaaagtcctggtggtggacgattcctccctgatgaggcggctgattagc
cgcctattggaggaagacaaaggaataaaagtcattggcaccgctgcggatggactggag
gccctacaacaaattaaggccctgcggcccgatgtggtaaccatggatgtggagatgccc
aggttggacggtattgccaccctgcgccgcttgatggtggattttcctacaccagcggtg
atgctcagtgcccatacccatgagggtgcccgggccaccatggatgccctgtccgccggg
gcagtagattttgtggcaaaacccacttcctccgctgaattaccaaggatggtggaggat
ctcaagaccaaagtaaaggtagcggccagggtttccctgcgcagggtgcgaaccacccta
acaccgccgccggcaccgctggctcggcctaagccagccacaacagccgcccctgggtca
gctaaagcgaagccccagacccaggttcgaaggcagccctattgcggcaaaattgatcta
gtggtcattggctgctccaccggtggccccgcagccctgcagcaaatcattccctacctg
cctgccaatttacccgccggggttgtggtggttcaacatattccagtgggtttttccaaa
tccatggcagagcatttggataagaaaagtgccatctcggtacgtcatgccgcagagggt
gatgcaataaaagcaggccaggtactggttgccccggcgggctacgacttaaactttaag
gccaaaggcaacggctccaccgttgccctgagtaatcaaggggctcctttggctcccggg
ggtttccgcccttcggtggattgggtgatgaaatctgccgccgaagtctatggttgccga
accctagccgtactattaactgggatgggacgagacggtgccagagggatgctggccatc
aaagaacagggtggccctaccatcgctgagcacgaaagtacctgtgtggtttatggcatg
cccaaggcagcctacgatattggggctgcgggtaaaatggtacccttaccacagattgcc
caggaaatccaagctttttttgatgtttaa

DBGET integrated database retrieval system