KEGG   Desulfotomaculum reducens: Dred_2845Help
Entry
Dred_2845         CDS       T00494                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
drm  Desulfotomaculum reducens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dred_2845
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dred_2845
Exosome [BR:drm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dred_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3087433..3088938)
Genome map
AA seq 501 aa AA seqDB search
MMAKKYVLALDQGTTSCRAILFDRDSNIVGVAQKEFTQIYPKPGWVEHNAEEIWSTQYGV
IAEVVAKTGIKPEEIASIGITNQRETTVVWNKNTGKPVYNAIVWQCRRTTEICDELKVKG
LEETFKKKTGLVVDAYFSGTKVKWILDNVPGTREMAEKGELLFGTMDTWLIWKLTGGQVH
VTDYSNASRTLMYNIRELCWDEELLGYLNVPMSLLPTVKASSEVYGYTQPDQFLGHSVPI
AGVAGDQQAALFGQACYEPGMAKNTYGTGCFMLMNTGDEVYESKNGLLTTIAWGLDGKVT
YALEGSIFIAGAAIQWLRDGLKILESAPDSEYFASKVDGTDGVYLVPAFAGLGAPYWDMR
ARGAIVGLTRGTTKEHIIRAALDSLAYQTKDVLGAMEADSNIKLQALKVDGGAVANNLLM
QFQADILGVPVERPQVIETTALGAAYLAGLAVGFWESKEELAKRWKLDYQFESVMAEDQR
NKLYNGWEKAVGRSMDWATEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgaaaaagtatgtactggccttggatcaagggacaaccagttgtcgggcaatt
ttatttgaccgagatagcaacattgtaggtgtagcccaaaaggagttcacacaaatttac
cctaagccaggttgggtggagcataatgccgaagaaatctggagtacccagtatggcgtc
attgccgaagtcgttgccaaaaccggtatcaaacctgaggaaattgcctccattggtatt
actaaccagcgtgaaacaacggtggtctggaataagaacacaggcaaaccagtttataat
gccattgtttggcaatgccggcgtacaactgagatttgtgatgaattgaaggtgaaaggt
ctagaggaaacctttaaaaagaagacaggtctggtggtggatgcctacttctctggcacc
aaggtgaaatggatactagataatgtgcccggtacccgtgaaatggctgaaaagggcgaa
cttctttttggaaccatggatacctggcttatctggaaacttaccggtggtcaagttcac
gtgacagattattctaatgcttcccgtacgttgatgtacaatattcgtgaactgtgttgg
gatgaggaattactgggatatctaaatgtgccgatgagcctgttgcccactgtcaaagct
tccagtgaagtatatggctatactcaaccggatcaattccttggtcactctgtgcctatt
gctggtgtagctggggatcaacaggcagccctttttggacaggcttgctatgagccaggt
atggccaaaaacacctacggtactggttgctttatgttgatgaacacaggtgacgaagtc
tatgaatccaagaatggtcttttaacaactattgcctggggattggacggtaaagtaacc
tatgctttggaaggtagtatatttatcgcaggtgctgccatccagtggttaagggatggt
ttgaagatattagaatctgctccggattctgaatattttgccagcaaggtagatggtact
gatggagtttacttggtgcctgcctttgccgggctaggtgcaccttactgggatatgcgg
gccaggggagccatcgtagggctaaccaggggaaccacaaaggaacatatcattcgggcg
gccctagattccttggcctaccaaacgaaagatgtattaggagcaatggaagcagattcc
aatattaagttacaggcgttaaaagtggatggcggggctgtggcaaacaacctactgatg
caattccaagcagatattcttggtgtaccagtagagagaccccaggtaattgaaacaacg
gctttgggcgctgcatatctggccggactggcagtcggattttgggaaagcaaagaagaa
ctggccaagagatggaaactagattatcaatttgaaagtgttatggcagaagaccagaga
aataagctttacaatggctgggaaaaagcagttggtcgctccatggattgggctactgaa
gaataa

DBGET integrated database retrieval system