KEGG   Desulfotomaculum reducens: Dred_3037Help
Entry
Dred_3037         CDS       T00494                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
drm  Desulfotomaculum reducens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:drm00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:drm00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3296848..3297408)
Genome map
AA seq 186 aa AA seqDB search
MKFTDTNLDGVIIVEPAVFGDHRGWFMETYNESKFLEAGLTYKFVQDNQSFSAVKGTLRG
IHYQLNPKAQAKLVRCIRGAIFDIAVDIRKGSPNFGKWIGIKLTAENKKQLLIPRGFAHG
FMTLTEDVEVQYKVDELYAPELDRSILWSDPVIGIKWPMDITPLLSTKDEKAPLLEDAEN
NFSYGE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaccgatactaatttagatggtgtaattattgtcgaaccagctgtatttggt
gatcatcgtggctggtttatggaaacatataatgaatctaaattcttagaagcagggtta
acttataagtttgttcaagataatcaatcattttctgcagtaaaaggaacgttaagggga
atacattatcaactcaatcctaaggcccaggcaaaattggtacgttgcataaggggggct
atttttgatattgctgtagatattcgaaaagggagtccgaattttggtaaatggattgga
attaaattgacggcggaaaataaaaagcaattattaatcccaaggggatttgcacatggt
ttcatgactttaactgaagatgtggaggttcaatataaagtggacgagctatatgcccca
gaattggatcggagtatcctatggagtgaccctgttattggaattaaatggcctatggat
attacgcctctattatcaacaaaagatgaaaaggcaccattactagaggatgccgagaat
aacttcagctatggggagtag

DBGET integrated database retrieval system