KEGG   Desulfotomaculum reducens: Dred_3101Help
Entry
Dred_3101         CDS       T00494                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
drm  Desulfotomaculum reducens
Pathway
drm00040  Pentose and glucuronate interconversions
drm00052  Galactose metabolism
drm00500  Starch and sucrose metabolism
drm00520  Amino sugar and nucleotide sugar metabolism
drm01100  Metabolic pathways
drm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dred_3101
   00052 Galactose metabolism
    Dred_3101
   00500 Starch and sucrose metabolism
    Dred_3101
   00520 Amino sugar and nucleotide sugar metabolism
    Dred_3101
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dred_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABO51603
JGI: dred3101
UniProt: A4J950
Position
complement(3374293..3375159)
Genome map
AA seq 288 aa AA seqDB search
MRVRKAIIPAAGLGVRFLPATKATPKEMLPIVDTPTIQYIIEEAVASGIEDILIVTGRNK
RAIEDHFDKNLELEMQLDHKQKHELLGLVKDISEMVDIHYIRQKEPLGLGHAVYCARKFI
GDEPFAVLLGDDVIRSKVPCLKQMMNLYEEVRYSILGVQEVPQEHVNRYGIVEATTEQDN
VCRIYDLIEKPQIDQAPSRLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRKLVQAE
AIYGCMFEGKRYDVGDKLGYLKATVEFALERPDLSEDFRKYLKEIVSE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaggaaagccattataccggcggcgggtttgggtgtacggtttttgcctgcc
acaaaggcaactcccaaagaaatgttgcccattgtggataccccgaccattcaatacata
attgaagaagctgtggcctcgggcattgaagatatattaattgtaactgggcggaataaa
cgggccattgaagaccactttgacaagaatcttgaattggagatgcaattggaccataaa
cagaaacatgaattgttgggtttggttaaagatattagtgagatggtggatatccattac
atacgtcaaaaggaaccccttggcttaggccatgccgtctattgtgcccgcaagtttatt
ggggatgaaccctttgcagtgttgctgggtgatgatgtcattcggagcaaagtaccctgc
ctaaagcaaatgatgaacctctatgaagaagtacgatattctattctaggtgttcaggaa
gtgccccaggagcatgtgaatcgttatgggattgtggaggccaccacagagcaagacaat
gtctgccgcatttacgacctaatagaaaaaccacagattgatcaggctccctctaggttg
gctgtgatgggaaggtatatactaagtcccagaatctttgatatcttggccatgacccgt
cccggggccggtggtgaaatacaattgaccgatgccctaagaaagttggtgcaggccgaa
gccatctatggctgcatgttcgaaggaaaacgttatgatgtgggcgacaaattgggatat
ctaaaggccaccgttgagtttgccctggaaaggccggacctgtcagaggattttaggaag
taccttaaggaaattgtatcagaataa

DBGET integrated database retrieval system