KEGG   Desulfotomaculum reducens: Dred_3101Help
Entry
Dred_3101         CDS       T00494                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
drm  Desulfotomaculum reducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dred_3101
   00052 Galactose metabolism
    Dred_3101
   00500 Starch and sucrose metabolism
    Dred_3101
   00520 Amino sugar and nucleotide sugar metabolism
    Dred_3101
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dred_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3374293..3375159)
Genome map
AA seq 288 aa AA seqDB search
MRVRKAIIPAAGLGVRFLPATKATPKEMLPIVDTPTIQYIIEEAVASGIEDILIVTGRNK
RAIEDHFDKNLELEMQLDHKQKHELLGLVKDISEMVDIHYIRQKEPLGLGHAVYCARKFI
GDEPFAVLLGDDVIRSKVPCLKQMMNLYEEVRYSILGVQEVPQEHVNRYGIVEATTEQDN
VCRIYDLIEKPQIDQAPSRLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRKLVQAE
AIYGCMFEGKRYDVGDKLGYLKATVEFALERPDLSEDFRKYLKEIVSE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaggaaagccattataccggcggcgggtttgggtgtacggtttttgcctgcc
acaaaggcaactcccaaagaaatgttgcccattgtggataccccgaccattcaatacata
attgaagaagctgtggcctcgggcattgaagatatattaattgtaactgggcggaataaa
cgggccattgaagaccactttgacaagaatcttgaattggagatgcaattggaccataaa
cagaaacatgaattgttgggtttggttaaagatattagtgagatggtggatatccattac
atacgtcaaaaggaaccccttggcttaggccatgccgtctattgtgcccgcaagtttatt
ggggatgaaccctttgcagtgttgctgggtgatgatgtcattcggagcaaagtaccctgc
ctaaagcaaatgatgaacctctatgaagaagtacgatattctattctaggtgttcaggaa
gtgccccaggagcatgtgaatcgttatgggattgtggaggccaccacagagcaagacaat
gtctgccgcatttacgacctaatagaaaaaccacagattgatcaggctccctctaggttg
gctgtgatgggaaggtatatactaagtcccagaatctttgatatcttggccatgacccgt
cccggggccggtggtgaaatacaattgaccgatgccctaagaaagttggtgcaggccgaa
gccatctatggctgcatgttcgaaggaaaacgttatgatgtgggcgacaaattgggatat
ctaaaggccaccgttgagtttgccctggaaaggccggacctgtcagaggattttaggaag
taccttaaggaaattgtatcagaataa

DBGET integrated database retrieval system