KEGG   Desulfotomaculum reducens: Dred_3101Help
Entry
Dred_3101         CDS       T00494                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase GalU
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
drm  Desulfotomaculum reducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:drm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dred_3101
   00052 Galactose metabolism
    Dred_3101
   00500 Starch and sucrose metabolism
    Dred_3101
   00520 Amino sugar and nucleotide sugar metabolism
    Dred_3101
Enzymes [BR:drm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dred_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3374293..3375159)
Genome map
AA seq 288 aa AA seqDB search
MRVRKAIIPAAGLGVRFLPATKATPKEMLPIVDTPTIQYIIEEAVASGIEDILIVTGRNK
RAIEDHFDKNLELEMQLDHKQKHELLGLVKDISEMVDIHYIRQKEPLGLGHAVYCARKFI
GDEPFAVLLGDDVIRSKVPCLKQMMNLYEEVRYSILGVQEVPQEHVNRYGIVEATTEQDN
VCRIYDLIEKPQIDQAPSRLAVMGRYILSPRIFDILAMTRPGAGGEIQLTDALRKLVQAE
AIYGCMFEGKRYDVGDKLGYLKATVEFALERPDLSEDFRKYLKEIVSE
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaggaaagccattataccggcggcgggtttgggtgtacggtttttgcctgcc
acaaaggcaactcccaaagaaatgttgcccattgtggataccccgaccattcaatacata
attgaagaagctgtggcctcgggcattgaagatatattaattgtaactgggcggaataaa
cgggccattgaagaccactttgacaagaatcttgaattggagatgcaattggaccataaa
cagaaacatgaattgttgggtttggttaaagatattagtgagatggtggatatccattac
atacgtcaaaaggaaccccttggcttaggccatgccgtctattgtgcccgcaagtttatt
ggggatgaaccctttgcagtgttgctgggtgatgatgtcattcggagcaaagtaccctgc
ctaaagcaaatgatgaacctctatgaagaagtacgatattctattctaggtgttcaggaa
gtgccccaggagcatgtgaatcgttatgggattgtggaggccaccacagagcaagacaat
gtctgccgcatttacgacctaatagaaaaaccacagattgatcaggctccctctaggttg
gctgtgatgggaaggtatatactaagtcccagaatctttgatatcttggccatgacccgt
cccggggccggtggtgaaatacaattgaccgatgccctaagaaagttggtgcaggccgaa
gccatctatggctgcatgttcgaaggaaaacgttatgatgtgggcgacaaattgggatat
ctaaaggccaccgttgagtttgccctggaaaggccggacctgtcagaggattttaggaag
taccttaaggaaattgtatcagaataa

DBGET integrated database retrieval system