KEGG   Desulfohalobium retbaense: Dret_0036Help
Entry
Dret_0036         CDS       T00989                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
drt  Desulfohalobium retbaense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dret_0036
Enzymes [BR:drt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dret_0036
Exosome [BR:drt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dret_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
42778..44685
Genome map
AA seq 635 aa AA seqDB search
MTRMRYDHTLLTDMDIYLFKQGRHYKLYDKLGAHPMQLDGQDGVQFGVWAPNATAVAVMG
DFNDWQTASHPLQVRGDGSGIWEGFVPGLGQGELYKYAIIGQDGQMFSKTDPFAFFWETA
PQTASVVWDLDYRWQDETWMEQRHERNHLNAPMSVYEVHPGSWRQRDGRFLSYRELAEEL
ATYVQECGFTHVEFMPVMEHPFYGSWGYQTLGFFAPSSRYGTPQDFMYLMEYLHQEGIGV
ILDWVPSHFPQDAHGLVYFDGTHLFEHADPKLGFHPEWKSAIFNYARYEVQSFLISSANF
WIDRYHADGLRVDGVASMLYLDYAREDGEWIPNEYGGRENLGAIDFLRNLNSALYGEHPD
IITAAEESTDWPMVTRPVHVGGLGFGLKWNMGWMHDTLDFLANDPVYRKYHHNQLTFSIM
YAFSENFILPLSHDEVVYGKGSLINKMPGDDWQKRANLRLMLGYMYTHPGKKLLFMGGEI
GQWNEWNHDTELDWWLLDNPDHQGLRRWVGDLNRVYRDYPALSDLDFQSGGFAWIDCSDW
EQSVISYLRWDASGQRPLLVVANFTPMPRANYRIGVPFAGLWHELLNSDAPLYGGSGQGN
MGGVTSVPVPAHGFYDSLTLTLPPLAVEVFTPEGA
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcatgcgctacgaccacaccctgctgactgatatggatatttatctttttaaa
caggggcggcattacaagctttatgacaaactcggcgcacacccgatgcaactcgacggc
caggacggggtgcaatttggggtctgggcgcccaacgccaccgctgtggcggtcatgggg
gacttcaacgactggcagaccgcgagccacccgctccaggtccgcggcgacggttctggc
atctgggaggggtttgtccccggtctcgggcagggggaattgtataaatacgcgattatc
ggtcaggacggacagatgttctccaagaccgaccccttcgcttttttctgggagaccgca
ccccagacggcttctgtggtctgggatctcgactaccgttggcaggacgagacctggatg
gaacagcgacacgagaggaaccatctcaacgcgcccatgtcggtctacgaggtccatccc
ggttcctggcgccaacgcgacggtcgtttcctcagttaccgcgaattggccgaagaactc
gcgacgtacgttcaggaatgcggttttacccatgtcgaattcatgccggtcatggagcat
cctttctacgggtcctggggctatcagaccttgggcttttttgcgccttcaagccgctat
ggcacaccgcaggatttcatgtatctcatggagtatctgcaccaggagggcatcggggtc
atcctggactgggtcccttcgcattttccgcaggacgctcacgggctggtctatttcgac
ggcacgcacttgtttgagcatgccgatccgaagctcggtttccacccggagtggaaaagc
gctattttcaattacgcccgctatgaggtgcagtcgtttctgatttctagcgcgaatttc
tggattgaccgctaccacgctgacggcctccgggtcgatggcgtggcttccatgctctat
ctggattacgcccgggaggacggcgaatggatccccaatgaatacggcggccgggaaaac
ctcggggccatcgattttctgcgcaatctcaattcggcgctttacggcgagcatccggac
atcatcaccgccgccgaggagtccacggactggccgatggtgacccggccggtccatgtc
ggcggactcggctttggcctgaaatggaacatgggctggatgcacgacaccctcgacttc
ctcgccaacgacccggtgtatcgcaaataccaccacaaccagctcaccttcagcatcatg
tatgctttttccgagaattttattctgcctctgtcccacgacgaggtggtctacggcaaa
ggttccctgatcaataagatgcccggggacgactggcaaaaacgggccaatctccgcctt
atgctcgggtatatgtacacccatcccgggaaaaagctgctctttatgggcggcgaaatc
gggcagtggaacgagtggaatcacgacacggagctcgactggtggctgttggataatccc
gatcaccagggactgcgccgctgggtcggtgatctcaacagggtctaccgcgactacccg
gcgttgtctgatctggatttccagtccgggggctttgcctggatcgattgctcggactgg
gaacagtcggtgatcagctatctgcgctgggatgccagcggccaacggccacttctcgtc
gtggccaacttcacgccaatgccgcgcgccaactatcgcatcggggtcccgttcgccggc
ttgtggcatgagctgctcaacagcgacgcccccctgtatggcggttccggtcaggggaat
atgggcggtgtgacttcggtgcctgttccggctcacggcttttatgattccttgacgttg
accttgccgcccctggcggtggaggtctttactccggagggagcatga

DBGET integrated database retrieval system