KEGG   Desulfohalobium retbaense: Dret_0041Help
Entry
Dret_0041         CDS       T00989                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
drt  Desulfohalobium retbaense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dret_0041
Enzymes [BR:drt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dret_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
52682..54190
Genome map
AA seq 502 aa AA seqDB search
MLTDRASGILLHITSLPGTYGVGDVGPQARRFVDFLAAAGQRYWQVLPVHPTQDGAGHSP
YSSTSAHAGNELLISPEDLVAEGLLGESHIRPWRRQAGESQAHYDWAQAAKRECCAVVQD
RLHRRLLPAFEAEFQDFCRTQRGWLDDFALFSAAKNHFGPRRSWRYWPEEIRLRQPRALQ
WMRQELALAIEREKLGQCLFFRQWRRLQARCRAKEVALMGDVPIYVDYESADVWSHPEYF
KLDATLRPPVVAGVPPDYFSATGQRWGNPVYDWRKLCQDGFHWWVDRLEGELQLCDVLRL
DHFRGFSACWEVPVEHETAENGSWVHVPGEALFALLQEHWGRLPLVAEDLGYITDEVRHL
KQRFDLPGMALLVFAFDGDPQNAFLPEHHDPNLVVYTGTHDTNTVRGWYEEEITAEQRSQ
LRRHLGHAPAASHVAQDLVRLALESRARTAILPLQDVLGLGSEARMNVPAAPEGNWIWRT
SSEALHEDVAAWLAEVTAASGR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgatcgcgccagcggtatcctgctccatatcacctccctgcccggcacctat
ggcgtgggcgatgtcggaccgcaggccaggcggtttgtggattttctcgccgccgccggc
cagcgctattggcaggttctccccgtgcacccgacccaggacggggccggtcactccccg
tacagcagcacctccgcccatgccggcaacgaactgctcatcagccccgaggatctggtc
gcggaggggctgctcggggaaagccacatccggccttggcggcgccaggccggggaatct
caggcgcattatgactgggctcaggccgccaaacgcgaatgctgtgctgtggtccaggat
cgcctccatcgtcgcctgcttcccgcctttgaggccgaattccaggacttctgccgcacc
cagcgcggctggctggacgactttgcgttgttcagcgctgcgaaaaaccattttggtccc
cggcggtcctggcggtattggcctgaggagatccgcctcaggcagccacgagcgttgcag
tggatgcgccaggaactcgccttggccattgaacgtgaaaagctcggtcaatgtctgttt
ttccgccaatggcgccgcctgcaggcccgttgccgcgccaaggaggtggccttgatgggc
gatgttcccatctatgtcgactatgaaagcgctgatgtctggagtcatccggaatatttc
aagctcgatgcaacgctccgtccgcctgtggtcgccggcgtgccgcccgactatttcagc
gctaccggccagcggtggggcaatccggtctatgattggcggaagttgtgtcaggacggc
ttccattggtgggtggatcgcctggagggcgaactgcagctgtgcgacgtcctgcgcttg
gaccatttccggggcttttccgcctgctgggaggtgccggtcgaacatgagaccgctgag
aacggctcttgggtccacgtcccgggcgaggcgttgttcgccttgttgcaggagcattgg
ggccgactgccacttgtggccgaggatctgggatatattaccgacgaggtccggcatctc
aagcaacgcttcgatttgcccggcatggcgctgctggtctttgcctttgatggggatccc
cagaacgcttttttgccggagcatcacgaccccaatctggtcgtttataccggcacgcac
gatacgaacaccgttcggggatggtacgaagaagaaatcactgcggagcagcggtctcag
ctccgccgtcatctcggtcatgcccccgctgcttcgcacgtggcccaggatctcgtccgc
ctggccctggagagccgggcgcggacggcgatcctcccgctacaggatgtgctggggctc
ggcagcgaggcccggatgaacgtacccgcggcccccgagggcaattggatctggcggact
tcctcagaagcactgcacgaagacgtggctgcctggctggctgaagtgacggctgccagc
ggccggtag

DBGET integrated database retrieval system