KEGG   Desulfohalobium retbaense: Dret_0122Help
Entry
Dret_0122         CDS       T00989                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01130  Biosynthesis of antibiotics
drt01230  Biosynthesis of amino acids
Module
drt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dret_0122
Enzymes [BR:drt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dret_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ACV67424
UniProt: C8WZE9
Position
161436..162254
Genome map
AA seq 272 aa AA seqDB search
MLDRFIEAKKEELERLRLQEANGTLPAPLEIDRPSLKRQLQEAPSVAVVAEYKRASPSKG
IINPRLGAKEAAEAYAAGGAAAISVLTEKAHFHGSLAFLERAQVAGLPLLRKDFLFHPLQ
IAESAATPAAAVLLIVRYFLETPGTLKTLVEQAQAYGLETVVEVFSEAEIDLARQAGADI
IQVNNRDLDTLQVDLDRSYALGKRKQAGEVWISASGINAPQHCVALGERGFDAVLVGTWL
MQHKEPAAALRYLRGVGPGMATAKSTPFFEQG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgaccggttcattgaggccaaaaaagaggaactcgagcgtctgcgcctgcaggag
gccaacgggactctgccggcgccgctggagattgaccgcccctcgctcaagcgccagtta
caagaggcaccgtccgtggctgtggtggccgaatataaacgggcttccccgtcaaagggg
attattaaccccaggctcggggccaaggaagcggccgaggcctatgcggccggcggagcg
gccgcgatttccgttttgaccgaaaaagcgcatttccatggctcgctggcctttttggaa
cgggcccaggtggcgggcttgccgctattgcgcaaggattttctcttccatccgctgcaa
attgcggaatcggccgcgacgccggcagccgccgtattgttgatcgttcgctattttctg
gagactccggggacccttaaaacgcttgtggagcaggcacaggcctatggtctggagaca
gtggtcgaggttttcagcgaagctgaaatcgacctggcgcggcaggcgggcgcggatatc
atccaggtcaacaatcgcgatctggacacgctgcaggttgacctggatcgctcctacgcc
ttgggcaagcgcaagcaggccggtgaagtctggatcagcgccagcggcatcaatgcaccg
cagcattgtgtcgccctgggcgaacgcggctttgatgctgttttggtgggcacttggttg
atgcaacacaaggagccagccgctgcgctgcggtatttacgcggtgttggcccggggatg
gctacggccaaaagcaccccgttttttgaacaaggataa

DBGET integrated database retrieval system