KEGG   Desulfohalobium retbaense: Dret_0122Help
Entry
Dret_0122         CDS       T00989                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
drt  Desulfohalobium retbaense
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dret_0122
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dret_0122
Enzymes [BR:drt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dret_0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
161436..162254
Genome map
AA seq 272 aa AA seqDB search
MLDRFIEAKKEELERLRLQEANGTLPAPLEIDRPSLKRQLQEAPSVAVVAEYKRASPSKG
IINPRLGAKEAAEAYAAGGAAAISVLTEKAHFHGSLAFLERAQVAGLPLLRKDFLFHPLQ
IAESAATPAAAVLLIVRYFLETPGTLKTLVEQAQAYGLETVVEVFSEAEIDLARQAGADI
IQVNNRDLDTLQVDLDRSYALGKRKQAGEVWISASGINAPQHCVALGERGFDAVLVGTWL
MQHKEPAAALRYLRGVGPGMATAKSTPFFEQG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgaccggttcattgaggccaaaaaagaggaactcgagcgtctgcgcctgcaggag
gccaacgggactctgccggcgccgctggagattgaccgcccctcgctcaagcgccagtta
caagaggcaccgtccgtggctgtggtggccgaatataaacgggcttccccgtcaaagggg
attattaaccccaggctcggggccaaggaagcggccgaggcctatgcggccggcggagcg
gccgcgatttccgttttgaccgaaaaagcgcatttccatggctcgctggcctttttggaa
cgggcccaggtggcgggcttgccgctattgcgcaaggattttctcttccatccgctgcaa
attgcggaatcggccgcgacgccggcagccgccgtattgttgatcgttcgctattttctg
gagactccggggacccttaaaacgcttgtggagcaggcacaggcctatggtctggagaca
gtggtcgaggttttcagcgaagctgaaatcgacctggcgcggcaggcgggcgcggatatc
atccaggtcaacaatcgcgatctggacacgctgcaggttgacctggatcgctcctacgcc
ttgggcaagcgcaagcaggccggtgaagtctggatcagcgccagcggcatcaatgcaccg
cagcattgtgtcgccctgggcgaacgcggctttgatgctgttttggtgggcacttggttg
atgcaacacaaggagccagccgctgcgctgcggtatttacgcggtgttggcccggggatg
gctacggccaaaagcaccccgttttttgaacaaggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system