KEGG   Desulfohalobium retbaense: Dret_0124Help
Entry
Dret_0124         CDS       T00989                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00260  Glycine, serine and threonine metabolism
drt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01130  Biosynthesis of antibiotics
drt01230  Biosynthesis of amino acids
Module
drt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dret_0124
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dret_0124
Enzymes [BR:drt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dret_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV67426
UniProt: C8WZF1
Position
163151..164356
Genome map
AA seq 401 aa AA seqDB search
MNTKTEFPDAGYYDGFGGQFVPELLMPPLIELEEAMQSVLPSQAFQEELAEVLQDYVGRP
TPLYRCRNLSKRLGFDLWLKREDLAHTGAHKINNTIGQALLAKHMGKRCLLAETGAGQHG
VATATAAAMLGMECIVYMGAKDVQRQAHNVHRMRLLGAKVEAVDSGTQTLKDAISATLRH
WIRDQATAHYCIGSVVGPHPFPALVRDLQSVIGTETIAQCQKKMGGLPDVVLACVGGGSN
AMGMFHPFTDYPEVRLIGVEAAGSGEEGCTHSATLSQGTEGVLQGARTYLLQTQAGQILP
SHSVAPGLDYPGVGPEHVAFMTSGRAEYVCVCDDVALEAFYTLSRDEGIIPALESSHALA
YAMALQGEIPSGSRVVVTLSGRGDKDLGIVREREGAAETKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaacagaattcccggatgccggatattacgacggattcggcggccagttt
gtccctgaattgctgatgccgcccttgatcgaattggaagaggcgatgcagtctgtcctg
cccagtcaggcgtttcaagaggagttggctgaagtcctccaggattacgtggggcgaccg
acgccgttgtatcgatgccgtaatctttccaagcgacttggattcgacctgtggctcaaa
cgtgaggacctggcgcatacaggcgcgcataagatcaacaacaccatcggacaggccctc
ttggccaagcatatgggcaagcggtgcctgttggccgaaaccggagcggggcagcacggg
gtggccacagccacggctgcggccatgctgggtatggagtgcatcgtgtatatgggggcc
aaagatgtgcagcgccaagcccataacgttcaccggatgcgtcttctgggggcgaaggtg
gaagcggtggacagcgggacccagacattgaaggacgccatcagcgcgaccttgcggcac
tggatccgggaccaggccacggcgcactattgtatcggctccgtcgtcggcccccatcct
ttcccggccctggtccgcgacctgcagtcggtgatcggtacggaaacgattgcgcagtgc
cagaagaaaatgggcgggctgccggacgtggtgctggcctgtgttggtgggggctccaac
gccatgggcatgttccacccgttcaccgattatccggaggtccgcctgattggtgtggaa
gccgcgggcagcggcgaagaggggtgcacccattccgcgacgttgagccaggggaccgaa
ggggtgttgcagggcgcgcgaacctatctgctccagacccaggccggacaaatcctgccc
tcgcattccgtggccccggggctcgactacccaggggtcggcccggaacatgtggccttc
atgacctcaggtcgggctgaatatgtctgtgtctgcgacgatgtggccctggaagccttt
tataccctttcccgggacgaggggatcattccggccctggaaagttcccatgccctggcc
tacgccatggcgctgcaaggagaaatcccatccggcagccgcgtggtcgtcacgctgtcc
gggcgcggggacaaggatttgggcatcgtccgggagcgcgaaggcgctgcggagaccaag
gcgtag

DBGET integrated database retrieval system