KEGG   Desulfohalobium retbaense: Dret_0124Help
Entry
Dret_0124         CDS       T00989                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
drt  Desulfohalobium retbaense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dret_0124
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dret_0124
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dret_0124
Enzymes [BR:drt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dret_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
163151..164356
Genome map
AA seq 401 aa AA seqDB search
MNTKTEFPDAGYYDGFGGQFVPELLMPPLIELEEAMQSVLPSQAFQEELAEVLQDYVGRP
TPLYRCRNLSKRLGFDLWLKREDLAHTGAHKINNTIGQALLAKHMGKRCLLAETGAGQHG
VATATAAAMLGMECIVYMGAKDVQRQAHNVHRMRLLGAKVEAVDSGTQTLKDAISATLRH
WIRDQATAHYCIGSVVGPHPFPALVRDLQSVIGTETIAQCQKKMGGLPDVVLACVGGGSN
AMGMFHPFTDYPEVRLIGVEAAGSGEEGCTHSATLSQGTEGVLQGARTYLLQTQAGQILP
SHSVAPGLDYPGVGPEHVAFMTSGRAEYVCVCDDVALEAFYTLSRDEGIIPALESSHALA
YAMALQGEIPSGSRVVVTLSGRGDKDLGIVREREGAAETKA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaaaaacagaattcccggatgccggatattacgacggattcggcggccagttt
gtccctgaattgctgatgccgcccttgatcgaattggaagaggcgatgcagtctgtcctg
cccagtcaggcgtttcaagaggagttggctgaagtcctccaggattacgtggggcgaccg
acgccgttgtatcgatgccgtaatctttccaagcgacttggattcgacctgtggctcaaa
cgtgaggacctggcgcatacaggcgcgcataagatcaacaacaccatcggacaggccctc
ttggccaagcatatgggcaagcggtgcctgttggccgaaaccggagcggggcagcacggg
gtggccacagccacggctgcggccatgctgggtatggagtgcatcgtgtatatgggggcc
aaagatgtgcagcgccaagcccataacgttcaccggatgcgtcttctgggggcgaaggtg
gaagcggtggacagcgggacccagacattgaaggacgccatcagcgcgaccttgcggcac
tggatccgggaccaggccacggcgcactattgtatcggctccgtcgtcggcccccatcct
ttcccggccctggtccgcgacctgcagtcggtgatcggtacggaaacgattgcgcagtgc
cagaagaaaatgggcgggctgccggacgtggtgctggcctgtgttggtgggggctccaac
gccatgggcatgttccacccgttcaccgattatccggaggtccgcctgattggtgtggaa
gccgcgggcagcggcgaagaggggtgcacccattccgcgacgttgagccaggggaccgaa
ggggtgttgcagggcgcgcgaacctatctgctccagacccaggccggacaaatcctgccc
tcgcattccgtggccccggggctcgactacccaggggtcggcccggaacatgtggccttc
atgacctcaggtcgggctgaatatgtctgtgtctgcgacgatgtggccctggaagccttt
tataccctttcccgggacgaggggatcattccggccctggaaagttcccatgccctggcc
tacgccatggcgctgcaaggagaaatcccatccggcagccgcgtggtcgtcacgctgtcc
gggcgcggggacaaggatttgggcatcgtccgggagcgcgaaggcgctgcggagaccaag
gcgtag

DBGET integrated database retrieval system