KEGG   Desulfohalobium retbaense: Dret_0125Help
Entry
Dret_0125         CDS       T00989                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00260  Glycine, serine and threonine metabolism
drt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01130  Biosynthesis of antibiotics
drt01230  Biosynthesis of amino acids
Module
drt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dret_0125
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dret_0125
Enzymes [BR:drt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dret_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACV67427
UniProt: C8WZF2
Position
164400..165167
Genome map
AA seq 255 aa AA seqDB search
MHTSVLTEAVDKAHKAGRHALIPFLPAGFPDPERFWEVLRELDAQGADIIEIGVPFSDPV
ADGPLIEAVSLQCLADGVDLDWILDGLERMAGQLATPIVCMGYYNPFWQYGMARFAERAA
QAGVAGCIVPDLPLEEAGPFQEVLNAQGMDLIRMIGVNTSEERMRAYAKNGSGFVYMVAA
LGITGTQAGFPPQLPQALSRAQDIFDDPIALGFGLERKEQLGEIRDLVDAVVFGSSLIRH
VQGGGEVRTFLQRWH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcatacatcagtgttgaccgaggccgttgacaaggctcacaaggccgggcgccacgcc
ctgatcccgtttcttccggccggatttcccgacccggaacggttttgggaggttttgcgg
gagctggacgcgcaaggtgcagatattattgagataggagtcccgttttccgatcccgtg
gccgatggtccacttattgaggccgtttcgttgcagtgcctggccgacggcgttgatctg
gactggatattggacggattggagcgtatggcggggcaattggcgaccccgatcgtgtgt
atggggtattataatcccttttggcaatacggcatggcccgttttgcggagcgagccgcc
caggcgggggtggccgggtgcattgtcccggatctgccgctggaggaggccgggccgttt
caagaggtactcaatgcacaaggaatggacctcatccgcatgatcggcgtgaatacctct
gaagagcggatgcgagcctatgccaaaaatggcagcggttttgtgtatatggttgcggca
ctgggcatcactggcacacaagccgggttcccgccgcaattgcctcaggcgctttcccgt
gcccaggacatttttgacgatcccattgctctggggttcggattggagcgtaaggaacaa
ctgggtgagatacgcgacctggtcgatgcggtggtcttcggcagcagtttgatccggcat
gtgcaaggcggcggggaggtcaggacatttttgcagagatggcactga

DBGET integrated database retrieval system