KEGG   Desulfohalobium retbaense: Dret_0163Help
Entry
Dret_0163         CDS       T00989                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
drt  Desulfohalobium retbaense
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dret_0163
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Dret_0163
Enzymes [BR:drt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dret_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
205967..207106
Genome map
AA seq 379 aa AA seqDB search
MGKRFARKVGLLGMVVGLLMATVTASAAASPSLEAMVGQMLMIGFRGTTFEAKSPLGEAI
TEGNLGGVVLYGRDVALNKPMRNIRSAAQLQALTADLQDHARIPLFIAVDEEGGQVSRLA
PRFGFPETVTAATWGRRNDPAWTRRGARAIGQRLRNLGCTINLAPVVDLNTNPDNPAIGK
LERSFGANPDTVTRQAAAFIHGLHDAGILACIKHFPGHGSAYNDSHLGLTDISTTWSPKE
LEPYKRLVDRGLADAVMTAHVFHAGLDPKVPATLSAEIIPDILRREIGYEGVVISDDLQM
GAIRQSFSLRQTVRRCLEADVDIFLFGNNLEYEPFVWRRVQRIVRDLVDQNIVSRSRIER
SYERIQRLKERMDLFQGRS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaggtttgcccggaaggtcgggttgctcggtatggtggttgggttgctgatg
gcgacggtgacggcctctgcggctgcgtcacccagcctagaggctatggtcggccaaatg
ctcatgatcggctttcgaggcacgacttttgaggccaaaagtcccctcggcgaggcgatt
acagagggcaatctgggcggtgtggtcctttatggccgagatgtggccctgaacaaaccg
atgcgcaatatccgctccgccgcccaactgcaggcgttgaccgctgaccttcaggaccac
gcccggattccgcttttcattgccgttgatgaggagggcggtcaggtcagccgcctcgcc
cctcggtttggctttcccgagactgtcacggcggcgacgtggggccgacgcaacgatcca
gcctggaccaggcgcggggccagggctatcgggcagcggctccggaaccttgggtgcacc
ataaatctcgcgccggtggttgatctgaacacgaaccccgacaatccggctatcggcaag
ctggaacggagtttcggggccaatccggacaccgtcacgcgccaggcggctgcgtttatc
cacgggctgcacgacgccggcattctggcctgcatcaagcattttccaggtcacggcagc
gcgtataacgattcccatctggggttgaccgatatcagcacgacctggtcgcccaaggaa
ttggaaccctataaacggctcgtcgaccggggactggcagacgctgtgatgaccgcccat
gtctttcatgccggattggatccgaaggtgccggcgacgttgtcggccgagatcattccc
gatattctgcgccgggagatcgggtatgagggggtggtgatcagcgacgatctgcagatg
ggggctattcgccagtcattttcgctgcggcagacggtgcgccggtgtctggaagcggat
gtggatattttcctgttcggcaataacctggagtatgagccgtttgtctggcgccgtgtc
cagcggatcgtgcgggaccttgtcgatcagaacattgtctctcgctcccgcatcgagcgc
tcctacgaacgaatccaaaggcttaaagagcggatggacctgtttcaagggagatcgtga

DBGET integrated database retrieval system