KEGG   Desulfohalobium retbaense: Dret_0294Help
Entry
Dret_0294         CDS       T00989                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00230  Purine metabolism
drt01100  Metabolic pathways
Module
drt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dret_0294
Enzymes [BR:drt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dret_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_18 AAA_16 AAA_28 AAA_22 KAP_NTPase AAA_25 NTPase_1 RsgA_GTPase MobB AAA_30 AAA_35 Rad17
Motif
Other DBs
NCBI-ProteinID: ACV67596
UniProt: C8WZX1
Position
complement(364202..364840)
Genome map
AA seq 212 aa AA seqDB search
MSHPERPGILLVLSAPSGTGKSTLIHRLTAEFPDFAFSVSYTTRAPRSGEIDGRDYHFVD
KDRFYELAEQDFFAEWAEVHGNCYGTPRQATLDMLSAGRHVLFDIDIQGARLLKANLGQG
HFVFLLPPSRQELEQRLRRRGSDNEEAIARRLENARQEIAAAREFDSWIVNDDLERAYDS
LRAVYLALTTRPAAQPQLPETILASWQEPQHG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcctgagcgtcctggtatcctgctggttctaagcgccccctcaggaacgggc
aaaagcaccctgatccatcgtctgaccgccgaattcccggatttcgctttttccgtgtcc
tatacaactcgagcgccccggtccggtgagatcgacggccgggactaccattttgtggac
aaggaccgcttttatgagctggccgagcaggatttttttgccgaatgggcggaggtacac
ggcaattgctacgggacccccagacaggcgaccctggacatgctctctgccggacggcat
gtccttttcgatatcgacatccagggcgcgcgcctgcttaaagccaaccttggacagggg
catttcgtctttctactccccccgtcgcgccaggagcttgaacagcggctccgtcgacgc
gggagcgacaacgaagaggccatcgcccgtcgccttgaaaacgcccggcaggaaatcgcc
gcggcccgggaattcgattcctggattgtcaacgatgacctggaacgagcgtacgattcg
ctgcgcgccgtctatctcgccctgaccacgcggcccgccgcccaaccccaattgcccgag
accattctcgcaagttggcaggagccgcaacatggctga

DBGET integrated database retrieval system