KEGG   Desulfohalobium retbaense: Dret_0331Help
Entry
Dret_0331         CDS       T00989                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
drt  Desulfohalobium retbaense
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dret_0331
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dret_0331
   00630 Glyoxylate and dicarboxylate metabolism
    Dret_0331
Enzymes [BR:drt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dret_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
414405..416594
Genome map
AA seq 729 aa AA seqDB search
MTEYVRSGGLQVAAPLAELVAQEVTPGIGVDPEKFWTALAQAVRDFAPRNAALLKERDRL
QEQIDQWFQDRRGQAHDAAAHKKFLYDIGYLIPEGEDFSIRTSDVDPEISAVAGPQLVVP
VNNPRYALNAANSRWGSLYDALYGTDVLPETDGAEKTAEYNPVRGEKVVEHAARFLDQAV
PLAQGSYTGVTGYAVRHDDGVARLEVALDDGSVTGLRDGQQFVGYVGEDRLSAVLFRHNG
LHIEIQIDPEDPIGRNHPAGVKDVVVEAAMTTILDCEDSVTAVDGVDKTVAYRNLLGLFR
GDLETSFSKGGQTVERRLHPDRSYTSPEGRLFHLHGRSLMLVRTVGHLMTSDAVLDEEGR
QIPEGILDTFMTALIGLHDLKKTGPFQNSRSGSLYIVKPKMHGPEEVAFTCELFAAAEES
LGLPSRTLKVGVMDEERRTTLNLKECIRQAQDRIIFINTGFLDRTGDEIHTNMEAGPMVR
KNEMKQEPWMQAYEDWNVDVGLAAGFRGRAQIGKGMWPKPNKMREMLETKQVHPEAGANC
AWVPSPTAATLHALHYHQVEVNARQVALEGQRRASLDDLLTIPVLRSAAPSEAEIQQELE
NNAQSILGYVVRWVEQGIGCSTVPDINDIGLMEDRATLRISSQHIANWLYHGICSKDEVL
AVLKRMAAVVDRQNSGDPFYRPMAEDFDNSVAFQAACDLVFKGCEQPNGYTEPILHARRR
EAKAKFGIE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtatgtccgtagtggaggactccaggtagcggcgccgttggccgagctggtg
gctcaggaggtgacgcccggaatcggcgtagatccggagaagttctggaccgctctcgcc
caggctgtgcgcgatttcgctccgcgcaatgcggctttgttgaaagagcgggaccggctg
caggagcagatagaccagtggttccaagaccgtcgcggtcaagcgcatgatgctgcggcg
cacaagaagtttttatacgatatcggctatttgattcccgagggcgaggatttttccatt
cggacttctgatgtggatccggagatttcggctgtggcggggccgcaattggtcgtgcct
gtcaataacccccggtatgcgctcaacgccgccaattcccgctggggcagcctctacgac
gccctctacggtacagatgtcctgccggaaaccgacggagcggagaagaccgcagaatac
aacccggtccgcggcgaaaaggtcgtcgaacacgccgcccgttttctggatcaggccgtc
cccctggcccagggctcctacaccggtgtgaccggatatgccgtccgccacgatgacggc
gtagcccgcttagaagtggcccttgacgatggatctgtcaccggattgcgcgacggacag
caatttgtgggctatgtgggggaggaccggttgtcagccgttctctttcgccataacggg
ctgcacattgagatccagatcgatcccgaggaccccatcgggcgcaatcacccggccggg
gtcaaggatgtggtggtcgaggcggccatgaccaccattctcgattgcgaggattcggtg
accgccgtggatggtgtggacaagacagtcgcctaccgcaatttgctgggcctttttcga
ggggacctggagacctcgttttccaagggcgggcaaaccgttgagcggcggctccacccg
gaccgcagctacacctcgcctgagggacgccttttccatctccacggccggagtctgatg
ctcgtacgcactgtcgggcatctcatgacttcggacgccgtgctggacgaagaggggcgg
cagatccccgaaggtatcctcgataccttcatgaccgcgcttatcggattgcatgatctg
aaaaagaccggcccgttccagaacagccgtagcggcagcctgtatatcgtcaaacccaaa
atgcacggtccggaggaagtggccttcacctgcgagctgttcgcggcggcggaagaatcc
ctgggcctgcccagccggaccttgaaagtcggggtcatggacgaagagcggcggaccacg
ctcaacctcaaagaatgcatccgtcaggcccaggaccggattatttttatcaataccggg
tttctggaccgcaccggcgacgagatccatacgaatatggaagccggccctatggtgcgc
aagaacgagatgaagcaggaaccctggatgcaggcctatgaggactggaacgtcgatgtc
ggattggccgccgggttccgcggacgggcccagatcggcaagggcatgtggcccaagccg
aacaagatgcgggagatgctcgagaccaaacaggtccatcccgaggcgggcgccaattgc
gcctgggtgccctcgcccacggcagcgactctgcacgccctgcactaccaccaagtggag
gtgaacgcccggcaggtcgccctcgaagggcagcggcgggcttcgctggatgatttgttg
accattccggtgctgcggtctgcggctccgtcggaggcggagatccagcaggagttggaa
aacaatgcccagagcatcctgggctatgtcgtgcgctgggtggaacagggcatcggctgt
tcgacggtgccggatatcaacgatatcgggttgatggaagatcgggcgactttgcgcatt
tccagtcagcatatcgccaactggctctatcacgggatatgcagcaaggacgaggtcctg
gcggtgctcaaacgcatggcggctgtggtcgatcgccagaacagcggggatccgttctac
cgtcccatggccgaggactttgacaatagcgtggcctttcaggcggcgtgtgatctggta
ttcaaagggtgtgaacagcccaatgggtataccgaacccattttgcacgcccgtcgccgg
gaagcgaaagcgaaattcgggattgagtga

DBGET integrated database retrieval system