KEGG   Desulfohalobium retbaense: Dret_0508Help
Entry
Dret_0508         CDS       T00989                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
drt  Desulfohalobium retbaense
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:drt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
616417..617028
Genome map
AA seq 203 aa AA seqDB search
MQSNKLPAPLRKVVDELAQLPGVGPKSALRMGLTLLKWPQEKAEGLGESIKQLRRTLCLC
EQCASLTDQNPCAICADVARDGSVLCLIPDWDSLLVMEEAGFFRGKYFVLGGLLSPLDGV
NPDQLELDRLEKRLDQGEIREVVLALGTTTEAEATESHLKNLLHRKYPDLRVARLAQGIP
LGAHLKFMDRETLKQSMQYRQSL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcaataaactccctgcccccttgcgcaaggtagtcgacgagttggctcaatta
ccaggagtcggccccaagtccgccttgcgcatggggctgacgcttttgaaatggccccag
gaaaaggccgaagggttgggcgagtcgatcaagcagctgcggcggacattgtgtctgtgc
gagcagtgcgccagcctgacggaccagaatccctgcgctatttgtgccgacgttgcccgc
gatggttctgtgctctgtttgatcccggattgggattcgcttttggtcatggaagaggcg
gggttcttccggggcaagtattttgtgctcggcggactgctttcgccgttggacggcgtc
aatcctgaccaactggagttggaccgcctagagaagcggctggatcagggcgaaatccgg
gaggttgtcctggccctggggacgaccacagaggccgaagccactgaatcccacctcaaa
aacctcctgcatcgcaagtatcccgacctccgtgtcgctcgcctggcgcaggggattccg
ctgggggcccacctgaagttcatggaccgggagaccctgaaacaatccatgcagtaccgc
caatccctctga

DBGET integrated database retrieval system