KEGG   Desulfohalobium retbaense: Dret_0508Help
Entry
Dret_0508         CDS       T00989                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
drt  Desulfohalobium retbaense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:drt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dret_0508
DNA repair and recombination proteins [BR:drt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dret_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
616417..617028
Genome map
AA seq 203 aa AA seqDB search
MQSNKLPAPLRKVVDELAQLPGVGPKSALRMGLTLLKWPQEKAEGLGESIKQLRRTLCLC
EQCASLTDQNPCAICADVARDGSVLCLIPDWDSLLVMEEAGFFRGKYFVLGGLLSPLDGV
NPDQLELDRLEKRLDQGEIREVVLALGTTTEAEATESHLKNLLHRKYPDLRVARLAQGIP
LGAHLKFMDRETLKQSMQYRQSL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcaataaactccctgcccccttgcgcaaggtagtcgacgagttggctcaatta
ccaggagtcggccccaagtccgccttgcgcatggggctgacgcttttgaaatggccccag
gaaaaggccgaagggttgggcgagtcgatcaagcagctgcggcggacattgtgtctgtgc
gagcagtgcgccagcctgacggaccagaatccctgcgctatttgtgccgacgttgcccgc
gatggttctgtgctctgtttgatcccggattgggattcgcttttggtcatggaagaggcg
gggttcttccggggcaagtattttgtgctcggcggactgctttcgccgttggacggcgtc
aatcctgaccaactggagttggaccgcctagagaagcggctggatcagggcgaaatccgg
gaggttgtcctggccctggggacgaccacagaggccgaagccactgaatcccacctcaaa
aacctcctgcatcgcaagtatcccgacctccgtgtcgctcgcctggcgcaggggattccg
ctgggggcccacctgaagttcatggaccgggagaccctgaaacaatccatgcagtaccgc
caatccctctga

DBGET integrated database retrieval system