KEGG   Desulfohalobium retbaense: Dret_0509Help
Entry
Dret_0509         CDS       T00989                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
drt  Desulfohalobium retbaense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:drt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dret_0509
Enzymes [BR:drt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dret_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
617036..619222
Genome map
AA seq 728 aa AA seqDB search
MSATTLQAEIVSIVFHNPENDYVVARARAEGEPGQSTVVGIMPQVMPGEQVRLEGEWREH
PKFGRQFHAVSHTRELPATINGIRRYLASGRIKGVGPVMAERLVQFFGKDVLDILDNAPE
RLLEVEGLGKKTLEGIKASWDQQREVRNVMLFLQSHDVPPTYAGRIFARYGNQAVEKLQQ
NPYELAYEIRGIGFKTADTMALKLGFQEDSPERLEAGLVYTLFQFAEQGHMFYPGDELVH
KVTETLGVGDTGKVDGALARLEERKRVVVEDLPEQAVLRAVFLRHFHNWEAEIASRLTAL
VSHPAPVNEGKLDSILPGLEQKIGVALSSEQKEAVFEACANKTFILTGGPGTGKTTITQA
VVRGLGKLGYKIKLAAPTGRAAKRLSEATGASASTLHRLLGFSPDGAFAYNEEKKLKVDA
LVVDEASMLDCQLCVHLLRALPLTCRLILVGDVHQLPSVGAGNILEDLLESRAVPSRHLT
HIFRQAQESLIVVNAHRFNEGLFPTTSAKEPPEADFFWVEQDDPARVQEIIRQLVCERIP
AIYGLDPLRDVQVLSPMHKGEVGTQQLNTLLQQELNPSGPTLTRGNRMFRQGDRVLQTRN
NYEKDVFNGDLGWITAINADSQTMQIDFEGRDLTYEQGELDELTLAYAVSVHKSQGSEYP
AVVLPVVTQHFMLLQRNLIYTALTRAKSLAVLVGSSKALGIALNHKRGAERYTHLRYRLQ
DAANDIPY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaccaccctccaggctgaaatcgtcagtatcgtcttccacaatccggaaaat
gactatgttgtggccagggcccgggctgaaggggaacccggtcaatcgaccgtggtagga
atcatgccccaggtcatgcccggggagcaggtgcgcctggaaggggagtggcgggagcac
cccaaattcggccgtcaattccatgcggtgtcccatacccgggagttgccggccaccatc
aacgggatcagacgctatctcgcctcggggcggatcaagggagtcggcccggtgatggcc
gaacggctggtccagtttttcggcaaagacgtgctggatatcctggacaacgccccggag
cgccttttggaggtcgaggggctgggaaagaagacgctggagggaatcaaggcctcgtgg
gatcaacagcgcgaagtgcgtaacgtcatgctgtttttgcaaagccatgatgtgcccccg
acctatgccgggcgtattttcgcccgctacggcaatcaggccgtggagaaattgcagcaa
aatccctacgaactggcctacgaaatccggggcatcggtttcaagaccgcggacaccatg
gccttgaaactcggttttcaggaggacagccccgaacgcctggaggccggtctggtctac
accctgttccagttcgctgagcaggggcatatgttctaccccggcgatgaactcgtgcac
aaggtgaccgagaccctgggggtcggcgataccggcaaggtcgacggtgcgctggccaga
ctggaggagcgaaagcgggttgtcgtagaggatctgccggaacaggcggtccttcgggct
gtttttcttcgtcatttccacaattgggaggccgagatcgcttcccggctcaccgctttg
gtctcccatccggcaccggtcaacgaaggaaaattggattctattttaccggggctggag
cagaaaatcggcgtggccttgtcctctgaacaaaaggaagccgttttcgaggcgtgtgcc
aacaagacgtttattttgaccggcggcccgggaaccgggaagacgaccatcacccaggcc
gtggtccgcgggttggggaaactggggtacaagatcaagcttgcagcccccacgggacga
gcggccaaacggctttcagaggcgaccggtgcctcggcgagcacgctgcaccgcctgctc
ggattttccccggacggcgccttcgcctacaacgaggaaaagaagcttaaagtcgacgcg
ctggtggtcgatgaggcctccatgctggactgccagctgtgcgttcacctgttgcgcgcc
ctgccgttgacgtgccggttgatcctggtcggcgatgtgcaccaactgccctccgtcggg
gccggcaacatcctggaagacctgctcgagagccgcgccgtgcccagtcgccatctgacc
cacattttccggcaggcccaggaaagcctgatcgtggtcaacgcccaccgttttaacgaa
ggcttatttcccacgacctcagccaaggagcccccggaggccgattttttctgggtcgaa
caggatgacccggcccgggttcaggaaatcatcaggcaactggtctgcgagcggattccg
gcaatttacggccttgatcccctgcgcgacgtccaggtgttgagcccgatgcacaaaggg
gaagtcggcacccagcagctcaacacgcttttgcagcaggaactcaatccctcagggccg
accctgacgcggggcaaccggatgtttcgccagggagatcgggtcctgcagacccgcaat
aactatgaaaaagatgtctttaatggagatctgggctggattacggcgattaacgccgac
tcgcagaccatgcagatcgatttcgagggccgtgatctgacctatgaacagggcgaactt
gatgaactcaccttggcttacgccgtcagtgtgcataaatcccagggcagtgaatatccg
gccgttgtcctgccggtcgtgacccagcacttcatgcttttgcagcgcaatctgatctat
accgccctgacccgggccaagtctctggctgtgcttgttggcagcagtaaggccctgggc
atcgccctgaaccacaaacggggcgcagagcgctatacccacctccgttaccggctccaa
gacgcggccaacgacattccctattga

DBGET integrated database retrieval system