KEGG   Desulfohalobium retbaense: Dret_0773Help
Entry
Dret_0773         CDS       T00989                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
drt  Desulfohalobium retbaense
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dret_0773
   01230 Biosynthesis of amino acids
    Dret_0773
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_0773
  Energy metabolism
   00680 Methane metabolism
    Dret_0773
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dret_0773
Enzymes [BR:drt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dret_0773
Exosome [BR:drt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dret_0773
  Exosomal proteins of melanoma cells
   Dret_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
916970..917728
Genome map
AA seq 252 aa AA seqDB search
MFRIVLVRHGQSTWNKENKFTGWTDVPLSPAGEKEALRAAGQLLAAGLDFDICYTSFLKR
AIKTLWLIQEAMDRMWLPVVKQWCLNERHYGALQGLDKGQTAAQYGEEQVFQWRRGYAVR
PPALPEGDPRLPEHDPRYSRLQQAGRPRTESLADTVARVLPYWNREIVPRIQENRRVLLV
AHGNSLRALVKHLEGVSDEAITGLNIPTGIPLVYELGPDMKAIGSYYLGDAEEAATAAAE
VQDQGTASRSFG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgaatcgttttggttcgccacggtcagagcacttggaataaggagaataaattt
accggttggacggatgttccgctgagccctgcaggcgaaaaggaggcccttcgggcggcg
gggcaactccttgcggccggactggatttcgatatctgctatacctcttttttgaagcgg
gctatcaagacgttgtggttgatccaggaagccatggatcgcatgtggttgccggtggtc
aagcagtggtgtttgaacgaacgccattatggggcgttgcagggattggacaaaggacaa
accgctgcgcagtacggcgaggagcaagtattccagtggcggcggggctatgcggtccgc
ccgccagcactgccggaaggagatccccgattgccggaacacgacccgcgctattcgagg
ctccagcaggctggacgtccccggacagagagtctggcagataccgtggccagggtccta
ccgtattggaatcgagaaatcgtgccccggatccaggaaaatcgccgagttcttcttgtg
gcgcatgggaacagcctgcgggcactggtgaaacatttggagggcgtgagtgacgaggcc
atcaccgggctcaatatccctactggcatcccgctggtctatgaactcggtccggacatg
aaggcgattggctcctattatctgggcgatgcggaggaagcggcaaccgccgcggctgag
gtgcaagatcaggggacggcttcccgatcgtttggctga

DBGET integrated database retrieval system