KEGG   Desulfohalobium retbaense: Dret_0813Help
Entry
Dret_0813         CDS       T00989                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00010  Glycolysis / Gluconeogenesis
drt00052  Galactose metabolism
drt00500  Starch and sucrose metabolism
drt00520  Amino sugar and nucleotide sugar metabolism
drt00521  Streptomycin biosynthesis
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
drt01130  Biosynthesis of antibiotics
drt01200  Carbon metabolism
Module
drt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
drt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_0813
   00052 Galactose metabolism
    Dret_0813
   00500 Starch and sucrose metabolism
    Dret_0813
   00520 Amino sugar and nucleotide sugar metabolism
    Dret_0813
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dret_0813
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dret_0813
Enzymes [BR:drt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dret_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACV68104
UniProt: C8X107
Position
961056..961955
Genome map
AA seq 299 aa AA seqDB search
MYLVIDLGGTNIRGTWMDHDGAHGTIQHASRPRTLEGTKAHFKDLVDRLRETAPRPVRGV
GLATAGPLDHRAQKYLQTSNMPELNGFAIGDFVRREIGLPFLMENDAQAAALGEVWKGGI
AGATNAVVLTLGTGVGSGVILEGRLWRGGHFTGPELGHVFLGPGRSRACGCGQVGCIETW
LNKWAFERLASRCGLSQTQPRHVAQLWEQGNPAATACVRRYGHRIGLAISTLQVVFGAEA
IGLSGGLSTFFQACEPYVWRTLRHRFTNRQWWLPATIAASPDPDMSGLWGMAKAWLDNG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgtaatcgatctgggtggaaccaatatccgcgggacctggatggaccatgat
ggagcccacggcacgatccagcacgcttcccgtccccggacgcttgagggaaccaaggcg
catttcaaggatcttgtcgaccgcttgcgagagacggctccgcgcccggttcgcggtgtc
ggactggccacggccggtcccctggaccacagggcccagaagtatttgcagacctcgaat
atgccggaactcaatgggttcgctattggggattttgtgcgccgggaaatcgggctgcct
ttcttgatggaaaatgatgctcaggcggccgccttgggagaggtctggaagggtggcata
gccggggcgacaaatgcggtggttttgaccctggggacgggtgtcgggtccggggtcata
cttgagggccgcttatggcgcggcggtcattttaccgggcccgaactcggtcatgtcttc
cttggtccaggcagatcccgggcctgtggttgtggacaggtcgggtgcatagaaacctgg
ctcaacaaatgggccttcgagcgcttggcttcccggtgcggtctgagccagacgcagccg
cgccacgtggcccagctttgggagcagggaaaccctgctgccacggcttgtgtccggcgc
tacgggcaccggatcggcctggccatcagcaccctgcaggtggttttcggggccgaagcc
attggtctcagtggaggcttgagtactttttttcaggcctgtgaaccgtatgtctggcgt
acattgcgccaccggttcaccaaccggcaatggtggcttcctgcgaccatcgctgccagc
cctgatccggacatgagcgggttgtggggtatggccaaggcttggttggacaacggctga

DBGET integrated database retrieval system