KEGG   Desulfohalobium retbaense: Dret_0818Help
Entry
Dret_0818         CDS       T00989                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00010  Glycolysis / Gluconeogenesis
drt00620  Pyruvate metabolism
drt00640  Propanoate metabolism
drt00680  Methane metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
drt01130  Biosynthesis of antibiotics
drt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_0818
   00620 Pyruvate metabolism
    Dret_0818
   00640 Propanoate metabolism
    Dret_0818
  Energy metabolism
   00680 Methane metabolism
    Dret_0818
Enzymes [BR:drt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dret_0818
Lipid biosynthesis proteins [BR:drt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dret_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACV68109
UniProt: C8X112
Position
966115..967764
Genome map
AA seq 549 aa AA seqDB search
MLHKDCFSSLDDFTDNWRVPQWTGFNFAYDVVDHMAQTSPEKIAMVHVDDAHVRRDYTFE
FFAEASSRLAHALVKQGLGQGDRVMLMLNRRIEFWLGMLALHRIGAVAVPSPSMLTSKDI
EFRVNFAGIKGVFAEDALIDNFETVRPKCPGLKVCIHTGTEVQAQGWLAYETLVAEEATK
FERPKDAAADNDPLLIFFSSGTTGPPKMVEHTHRYPLGHIVTGMYWHDLEPGDLHLTLAD
TGWGKAVWGKFYGQWMAGAAIFVYDFRGKFDPHNLLSVLAEHKVTSFCAPPTVYRFLVRQ
DLGPYDLSALRHCTTAGELLNEGVFLKWREKTGLPIYEGYGQTETSLQIATFPFMDPKPG
SIGKATPQWDVVLLDESGQPCPPGVEGEICIRIADAEPEGLFTGYLDEPEKTRAVKTNGY
YHTGDKAWMDEDGYFWFLGRVDDLIKSSGYRIGPFEVESALITHPGVVEAAVTAVPDEIR
GQAVKATVVLAKGYTPSEALTKELQDHVKQVTAPYKYPRIISYVDDLPKTISGKIKRAEI
RAQDEHHQV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgttgcataaagactgtttttcgagtttggacgactttaccgataattggcgtgtgccc
caatggacaggatttaatttcgcttacgacgtggtggaccatatggcccaaacttccccg
gagaagatcgcgatggtccatgtcgatgatgcccacgtcagacgagactatacgtttgaa
ttttttgccgaagcatccagccggctggctcacgctctggtcaaacagggactcggtcaa
ggggaccgggttatgctcatgctcaaccgccgcattgagttctggctcggtatgcttgct
ttgcaccgcattggagctgtggctgtgccgtcgccgtccatgctgacaagtaaggatatc
gagttcagggtcaattttgccggtatcaaaggcgtttttgctgaagacgctctgatcgac
aattttgaaacggtgcgcccgaaatgcccggggctgaaagtctgtatccacaccgggacc
gaggtccaggctcagggctggcttgcctatgagacccttgtggccgaggaagcgaccaag
ttcgaacgtccaaaggatgcggccgctgacaacgatcccctgctgatctttttttcttcg
ggaacgacggggccgccgaaaatggtcgaacacacccaccgttatcccctggggcatatt
gtgaccgggatgtattggcatgatcttgagcccggagatctccatctgaccctggccgat
acagggtgggggaaagcagtctgggggaaattttacggccagtggatggctggcgcagcg
attttcgtctacgatttccggggaaaatttgatccccacaatttgttgtccgtgttggcg
gagcacaaagtgacgtccttttgcgctcccccgactgtttaccgatttctcgtccggcaa
gacctcgggccctatgacctgtcggcattgcgccattgcacaacggctggggaattgctg
aatgaaggggtttttctgaaatggcgggagaagaccggacttccgatctacgaaggctac
ggtcaaactgagacgtcgctgcaaatcgccacttttccctttatggaccccaagccgggc
tccatcggcaaggccaccccgcaatgggatgtcgtcctgcttgatgaaagcggtcaaccg
tgccccccgggcgttgaaggcgagatctgtattcgtatcgctgatgcagaaccggaggga
ttgttcaccggctatctggatgaaccggaaaaaacccgggccgtgaaaacgaatggctac
taccataccggagacaaggcctggatggatgaagacgggtatttctggtttcttggccgt
gtggatgatctgatcaaaagttcaggataccgcatcggcccttttgaggtcgaaagcgcc
ctgatcacccaccctggtgtcgtggaggccgccgtaaccgcagtgccggatgagattcgc
ggccaggcggtcaaggccacggtggtcctggccaaggggtatacgccatcagaggcgttg
accaaggagttgcaggaccatgtcaaacaggtcaccgcgccctataaatatccccgtatc
atttcctacgtcgatgacttgcccaaaaccataagcggcaagatcaagcgggctgagatc
cgagcgcaagacgagcatcaccaggtttga

DBGET integrated database retrieval system