KEGG   Desulfohalobium retbaense: Dret_1099Help
Entry
Dret_1099         CDS       T00989                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
drt  Desulfohalobium retbaense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dret_1099
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dret_1099
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dret_1099
Enzymes [BR:drt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dret_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1288785..1290242
Genome map
AA seq 485 aa AA seqDB search
MSMSIHDFPAYRGVLEYVCLQCQARYPQDELLYTCPDCGGVFLLEDSRQESLKELSGAQW
RERFDARAAVKRRALRGIFRFYELIAPVLDEQDIVYLGEGQTPIIPSSPALNTAVGHTVA
MKNDGQNPSASFKDRGMACAFSYLQSMARANDWDQLLTICASTGDTSAAAALYAAYVGAP
LTSVVLLPAGKVTEQQLAQPLGSGAVVLEVPGVFDDCMRVVEYLADNYRVALLNSKNPWR
ILGQESYAYEVAQWYDWNLSDKALFVPIGNAGNITAIMSGLLKMHDLGIITALPQLFGVQ
TAHADPVFQYYRQPPESRSYSPVEVKPSVAQAAMIGNPVSFPRVRTLAERYEQVAGDGSF
QVVQVQEQAIMESMLLANRHGHIACTQGGECLAGLLRAKEEGRIDHKTTAVLDATAHSLK
FIGFQDRYFQNTFAPEYGITPQAQWQNRPETVIDPEVKNRLAADAFAREAAQAVVERLGL
EGKED
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgtcgattcatgatttccctgcctatcgcggcgtccttgagtatgtctgcctg
cagtgccaggcgcgctatccgcaggatgaattgctctatacctgcccggattgcggcggg
gtgtttttgcttgaagacagccgacaggagagcctgaaagagctttccggggcgcagtgg
cgggaacgctttgacgcccgggctgctgtcaaacgcagagcgctgcgggggatttttcga
ttttacgaactgatcgccccggtgcttgacgagcaggatatcgtctatctcggcgaaggg
cagacgccgatcataccgtccagcccggccttgaacacggcggtgggacacaccgtggcc
atgaaaaacgatggtcagaatccttcagcctctttcaaggatcggggcatggcttgtgcc
ttcagctatctgcaatccatggcccgggccaatgactgggatcagctgttgaccatctgc
gcctcgaccggcgatacctcggccgcagccgccttgtacgccgcctatgtcggggcgccg
ctgacatcagtggtcctcttgcccgcgggcaaggtcaccgaacagcagttggcgcagcct
ttgggcagcggagcagtggtccttgaggtgcccggcgtatttgacgattgtatgcgggtc
gtggaatatcttgctgataactatcgagtggccctgctgaattccaagaatccgtggcgc
attctgggccaggaatcctacgcctacgaagtcgcccaatggtatgattggaacctgagc
gacaaggcgctctttgtgcccattggcaatgccggcaatattacggccatcatgtccggg
ctgctgaagatgcacgacctgggcattatcaccgctctgccgcagttgttcggggtccag
accgctcacgccgacccggttttccagtattacagacaaccgcccgagagccggagttac
tcccctgtagaagtcaaaccgagcgtggcccaggcggccatgatcggtaatcctgtttcc
tttcccagggtgcgcaccttggctgagcgctacgagcaggtggcgggcgatggcagtttc
caggtcgtccaggtccaggaacaggcgatcatggaatccatgttgctggccaaccggcac
gggcacatcgcctgcacccagggtggggaatgtctggccgggttgctccgggccaaggaa
gaaggccgtatcgaccacaaaacgaccgcggtcttggacgcgacggcccacagcctgaag
ttcatcggtttccaggaccggtattttcaaaatacctttgctccggaatacgggatcact
ccccaggcccaatggcagaacaggccggagacggttatcgatcctgaggtcaagaatcgt
ttggcagccgatgccttcgcccgggaggcggcccaggctgttgtcgaacgtctcggattg
gaagggaaggaggactga

DBGET integrated database retrieval system