KEGG   Desulfohalobium retbaense: Dret_1099Help
Entry
Dret_1099         CDS       T00989                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
drt  Desulfohalobium retbaense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dret_1099
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dret_1099
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dret_1099
Enzymes [BR:drt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dret_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1288785..1290242
Genome map
AA seq 485 aa AA seqDB search
MSMSIHDFPAYRGVLEYVCLQCQARYPQDELLYTCPDCGGVFLLEDSRQESLKELSGAQW
RERFDARAAVKRRALRGIFRFYELIAPVLDEQDIVYLGEGQTPIIPSSPALNTAVGHTVA
MKNDGQNPSASFKDRGMACAFSYLQSMARANDWDQLLTICASTGDTSAAAALYAAYVGAP
LTSVVLLPAGKVTEQQLAQPLGSGAVVLEVPGVFDDCMRVVEYLADNYRVALLNSKNPWR
ILGQESYAYEVAQWYDWNLSDKALFVPIGNAGNITAIMSGLLKMHDLGIITALPQLFGVQ
TAHADPVFQYYRQPPESRSYSPVEVKPSVAQAAMIGNPVSFPRVRTLAERYEQVAGDGSF
QVVQVQEQAIMESMLLANRHGHIACTQGGECLAGLLRAKEEGRIDHKTTAVLDATAHSLK
FIGFQDRYFQNTFAPEYGITPQAQWQNRPETVIDPEVKNRLAADAFAREAAQAVVERLGL
EGKED
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgtcgattcatgatttccctgcctatcgcggcgtccttgagtatgtctgcctg
cagtgccaggcgcgctatccgcaggatgaattgctctatacctgcccggattgcggcggg
gtgtttttgcttgaagacagccgacaggagagcctgaaagagctttccggggcgcagtgg
cgggaacgctttgacgcccgggctgctgtcaaacgcagagcgctgcgggggatttttcga
ttttacgaactgatcgccccggtgcttgacgagcaggatatcgtctatctcggcgaaggg
cagacgccgatcataccgtccagcccggccttgaacacggcggtgggacacaccgtggcc
atgaaaaacgatggtcagaatccttcagcctctttcaaggatcggggcatggcttgtgcc
ttcagctatctgcaatccatggcccgggccaatgactgggatcagctgttgaccatctgc
gcctcgaccggcgatacctcggccgcagccgccttgtacgccgcctatgtcggggcgccg
ctgacatcagtggtcctcttgcccgcgggcaaggtcaccgaacagcagttggcgcagcct
ttgggcagcggagcagtggtccttgaggtgcccggcgtatttgacgattgtatgcgggtc
gtggaatatcttgctgataactatcgagtggccctgctgaattccaagaatccgtggcgc
attctgggccaggaatcctacgcctacgaagtcgcccaatggtatgattggaacctgagc
gacaaggcgctctttgtgcccattggcaatgccggcaatattacggccatcatgtccggg
ctgctgaagatgcacgacctgggcattatcaccgctctgccgcagttgttcggggtccag
accgctcacgccgacccggttttccagtattacagacaaccgcccgagagccggagttac
tcccctgtagaagtcaaaccgagcgtggcccaggcggccatgatcggtaatcctgtttcc
tttcccagggtgcgcaccttggctgagcgctacgagcaggtggcgggcgatggcagtttc
caggtcgtccaggtccaggaacaggcgatcatggaatccatgttgctggccaaccggcac
gggcacatcgcctgcacccagggtggggaatgtctggccgggttgctccgggccaaggaa
gaaggccgtatcgaccacaaaacgaccgcggtcttggacgcgacggcccacagcctgaag
ttcatcggtttccaggaccggtattttcaaaatacctttgctccggaatacgggatcact
ccccaggcccaatggcagaacaggccggagacggttatcgatcctgaggtcaagaatcgt
ttggcagccgatgccttcgcccgggaggcggcccaggctgttgtcgaacgtctcggattg
gaagggaaggaggactga

DBGET integrated database retrieval system