KEGG   Desulfohalobium retbaense: Dret_1208Help
Entry
Dret_1208         CDS       T00989                                 

Definition
class IV aminotransferase
Orthology
K00824  
D-alanine transaminase [EC:2.6.1.21]
Organism
drt  Desulfohalobium retbaense
Pathway
Lysine degradation
Arginine and proline metabolism
Phenylalanine metabolism
D-Arginine and D-ornithine metabolism
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dret_1208
   00330 Arginine and proline metabolism
    Dret_1208
   00360 Phenylalanine metabolism
    Dret_1208
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dret_1208
   00473 D-Alanine metabolism
    Dret_1208
Enzymes [BR:drt01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.21  D-amino-acid transaminase
     Dret_1208
Amino acid related enzymes [BR:drt01007]
 Aminotransferase (transaminase)
  Class IV
   Dret_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1419977..1420831
Genome map
AA seq 284 aa AA seqDB search
MSRIVYVNGSYVPEEEATVSVFDRGFLFADGVYEVTAVVDGTILEFDGHVQRLERSLREL
DMDMPVTRETLLEIHRELIRRNNLEEGMVYLQVTRGEADRDFAYPKAAPQTLVLFTQAKS
LVDAPMAKQGLRVIAAEDLRWARRDVKTVQLVAPCMAKMLAKAEGKDDAWMVEDGYVTEG
TSNNAYIITKEGSIVTRNLSNSILPGITRAAVLKLAAEKGMAIEERPFTIAEAQEAAEAF
VTAATTFVCPVIEIDGVTIGNGTPGPLTSRLKELYIDEGRKTAL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaatcgtttacgtcaacggatcctatgttccggaagaagaagcgactgtttca
gtttttgacaggggatttttgttcgccgacggggtctatgaggtcacggctgtcgtcgac
ggcaccattctcgagttcgacggccacgtccagcgtctggagcgctcgttacgcgaattg
gatatggacatgccggtcacccgcgaaacgttgctggagatccaccgggaattgatccgg
cgcaataatcttgaggaaggaatggtctacctgcaggtcaccaggggcgaggccgatcgg
gatttcgcctacccgaaagctgcgccgcagaccttggtgctgtttacccaggccaaatcg
ctcgtcgatgccccgatggccaagcaggggctgcgggtcatcgcggccgaggatctccgc
tgggcccggcgggatgtcaagacggtccagcttgtggccccgtgcatggccaagatgctg
gccaaggccgaaggcaaggacgacgcctggatggtcgaagacggctatgtcaccgaaggc
acgtcgaacaacgcctatatcatcaccaaagagggctccatcgtgacccgaaacctctcc
aattccattttgccgggtatcacccgggcggctgtcctcaagctggctgcggaaaagggg
atggcgatcgaggagcggccgtttaccattgccgaggcccaggaggcggccgaggccttt
gtcactgcggccaccacctttgtctgtcccgtgatcgagatcgacggggtcaccatcggc
aacggcacaccagggccgctgacctcgcgactgaaggagttgtatattgacgaaggccgc
aagaccgctctctaa

DBGET integrated database retrieval system