KEGG   Desulfohalobium retbaense: Dret_1208Help
Entry
Dret_1208         CDS       T00989                                 

Definition
class IV aminotransferase
Orthology
K00824  
D-alanine transaminase [EC:2.6.1.21]
Organism
drt  Desulfohalobium retbaense
Pathway
Lysine degradation
Arginine and proline metabolism
Phenylalanine metabolism
D-Arginine and D-ornithine metabolism
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:drt00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:drt00330]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:drt00360]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:drt00472]
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:drt00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1419977..1420831
Genome map
AA seq 284 aa AA seqDB search
MSRIVYVNGSYVPEEEATVSVFDRGFLFADGVYEVTAVVDGTILEFDGHVQRLERSLREL
DMDMPVTRETLLEIHRELIRRNNLEEGMVYLQVTRGEADRDFAYPKAAPQTLVLFTQAKS
LVDAPMAKQGLRVIAAEDLRWARRDVKTVQLVAPCMAKMLAKAEGKDDAWMVEDGYVTEG
TSNNAYIITKEGSIVTRNLSNSILPGITRAAVLKLAAEKGMAIEERPFTIAEAQEAAEAF
VTAATTFVCPVIEIDGVTIGNGTPGPLTSRLKELYIDEGRKTAL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaatcgtttacgtcaacggatcctatgttccggaagaagaagcgactgtttca
gtttttgacaggggatttttgttcgccgacggggtctatgaggtcacggctgtcgtcgac
ggcaccattctcgagttcgacggccacgtccagcgtctggagcgctcgttacgcgaattg
gatatggacatgccggtcacccgcgaaacgttgctggagatccaccgggaattgatccgg
cgcaataatcttgaggaaggaatggtctacctgcaggtcaccaggggcgaggccgatcgg
gatttcgcctacccgaaagctgcgccgcagaccttggtgctgtttacccaggccaaatcg
ctcgtcgatgccccgatggccaagcaggggctgcgggtcatcgcggccgaggatctccgc
tgggcccggcgggatgtcaagacggtccagcttgtggccccgtgcatggccaagatgctg
gccaaggccgaaggcaaggacgacgcctggatggtcgaagacggctatgtcaccgaaggc
acgtcgaacaacgcctatatcatcaccaaagagggctccatcgtgacccgaaacctctcc
aattccattttgccgggtatcacccgggcggctgtcctcaagctggctgcggaaaagggg
atggcgatcgaggagcggccgtttaccattgccgaggcccaggaggcggccgaggccttt
gtcactgcggccaccacctttgtctgtcccgtgatcgagatcgacggggtcaccatcggc
aacggcacaccagggccgctgacctcgcgactgaaggagttgtatattgacgaaggccgc
aagaccgctctctaa

DBGET integrated database retrieval system