KEGG   Desulfohalobium retbaense: Dret_1313Help
Entry
Dret_1313         CDS       T00989                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
drt  Desulfohalobium retbaense
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dret_1313
Enzymes [BR:drt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Dret_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1538962..1539843)
Genome map
AA seq 293 aa AA seqDB search
MYTEYLDLETDNGRRVLVWPVPYEGTVSFGSGTENGPAAILRASAEIETWNEATGLDLAD
YAHFRTLSPFHPPVAGPQAVYEAMREKLRQDPAFDPARDFLLTLGGEHSVALAPIAAYAE
AYPDLVVLQIDAHADLRESFEGSPYSHACVMARVRELGLPLAQIGIRSLSRDESTTIHAS
GAHELLTLFAHDLPGPEEAAKRLREFVADRPLYLSFDADGLDPSVLPGTGTPEPGGLQLQ
WLNRFWTALGPALRLVGMDFCELAPQPAAGVVSESTAVQAINAVLLRTFAPTA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtataccgaatacctggatctggagacagacaacggacgccgggtcctggtctggccc
gtgccgtatgagggcacggtcagctttggcagtgggacggagaacggcccggcggccatc
ctccgggccagtgccgagatcgaaacctggaacgaggcgaccggtctggatttggccgat
tacgcccattttcgcaccttgtccccgttccatcccccggttgccggtccgcaggccgtg
tatgaggccatgcgggagaagctccggcaggatcccgcctttgatcctgctcgagacttc
ctgttgaccctgggcggagagcacagcgttgccctggcgccgatcgccgcctacgccgaa
gcctatccggacttggtcgtcctgcagatcgatgcccacgccgatttgcgggagagtttc
gaaggctcgccctactcccacgcctgtgtcatggctcgtgtccgggaactcggcctgcct
ctggcccagatcgggatccgcagcttaagccgtgacgagagcacgaccatccacgccagc
ggtgcgcacgaattgctgacgctgttcgcccacgatctgccaggtccggaggaagcggcg
aagcggttgcgggagtttgtcgccgaccgccccctctatctcagctttgacgccgacggc
ctggatccttctgtgttaccgggtaccggcacaccggagccgggaggactgcagctgcaa
tggctgaatcggttctggaccgctctggggcctgccctgcgcctggtgggaatggatttt
tgtgagctggcgcctcagcccgccgccggtgtggtctccgaatccacggccgtgcaggcc
atcaacgcggtcttgttacgaaccttcgccccgactgcctga

DBGET integrated database retrieval system