KEGG   Desulfohalobium retbaense: Dret_1331Help
Entry
Dret_1331         CDS       T00989                                 

Definition
uracil-DNA glycosylase
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
drt  Desulfohalobium retbaense
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:drt00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dret_1331
Enzymes [BR:drt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dret_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1557338..1558081
Genome map
AA seq 247 aa AA seqDB search
MAKQVLPQELADIALRLCHSLSSLSFSAPVTHVYNPLEYAWRGYRSYLEYAAWQPPILLV
GMNPGPWGMAQTGVPFGDKDLVSSWLGITAAVNRPPREHPKRPVQGFDCPRGEVSGQRLW
GWARDRFGSPERFFQKFFVANYCPLSFMEESGRNRTPDKLPVAERKTLFHTCDSALEETV
RLIAPEWVLGIGKFAAGRAAAACRELDVRIESVPHPSPASPLANQGWSRLMDARLAELGC
DGIRSSS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacaagtactgcctcaggaactggctgatatcgctttgcggctctgccattcc
ctgagttccttatccttttccgccccggtgacccacgtctacaacccccttgaatacgct
tggcgcgggtatcggtcctacctcgagtacgcggcctggcagccgccgatcctccttgtc
ggtatgaaccccgggccatggggcatggcccaaactggagtccccttcggcgacaaggac
ctggtgtcttcctggctgggaattacagcggctgttaacaggccgcctcgagagcatccc
aagcggcctgtccagggcttcgattgcccgcggggcgaggtcagcggccaacgcttgtgg
ggctgggccagagaccgtttcggttcaccggaacgcttttttcaaaagtttttcgtagcc
aattattgcccgctttcctttatggaggaatcggggcgcaaccgaacaccggacaaactt
ccggtcgcggaacgcaaaacccttttccacacgtgtgactcagccctcgaagaaaccgtc
cgtctcatagcccccgaatgggttttggggatcgggaaatttgccgctggacgcgccgct
gcggcctgccgggaactcgacgtgcgtatcgaaagcgtcccccatccgagtccggccagt
cccctggccaaccagggctggtcccgacttatggacgcgcgcttggccgagctcggctgt
gacgggattcgttcctcttcctga

DBGET integrated database retrieval system