KEGG   Desulfohalobium retbaense: Dret_1549Help
Entry
Dret_1549         CDS       T00989                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00010  Glycolysis / Gluconeogenesis
drt00051  Fructose and mannose metabolism
drt00562  Inositol phosphate metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
drt01130  Biosynthesis of antibiotics
drt01200  Carbon metabolism
drt01230  Biosynthesis of amino acids
Module
drt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
drt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_1549
   00051 Fructose and mannose metabolism
    Dret_1549
   00562 Inositol phosphate metabolism
    Dret_1549
Enzymes [BR:drt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dret_1549
Exosome [BR:drt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dret_1549
  Exosomal proteins of bladder cancer cells
   Dret_1549
  Exosomal proteins of melanoma cells
   Dret_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACV68833
UniProt: C8X336
Position
complement(1792723..1793481)
Genome map
AA seq 252 aa AA seqDB search
MPKPLMAANWKMFKTSTQALEFFEDFSETLDSTVLKDRDVLFLPPFTSLEALSDPVRFAG
FSIGAQNCYPAAEGAFTGEIAPGMLLDLGCDYVLTGHSERRHVLGESDEFVGQKTAFALD
QGLGVILCIGETLEQRKAGQVETVLKRQLESGLRDVPNDVPAEALTIAYEPVWAIGTGEV
AQDEDIREAHATVRGLLADRLSAAADIRILYGGSVKPANCAQILSLDNVNGVLVGGASLQ
AASFVDIVSAGL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacccctcatggccgccaattggaagatgttcaagacgagcacccaggccctg
gagttttttgaagacttttccgagaccctcgacagcacggtcctcaaggaccgcgacgtg
ctttttctgccgccgtttacctccctggaagccctgtcggatccagtgcgtttcgcgggc
ttcagcatcggcgcccagaactgctacccggccgccgaaggcgccttcaccggggagatt
gccccggggatgcttttggatctcggctgcgactatgtgttgaccggccattccgagcgc
cgccacgtcctcggcgaatcggacgaattcgtgggccagaagactgccttcgctctggac
caggggctcggggtcatcctgtgcatcggcgagacactggagcagcgcaaggcggggcag
gtggaaaccgtcctcaagcgtcagcttgaaagcggcctgcgcgacgttcccaatgacgtg
cccgccgaagccctgaccatcgcctacgaaccggtctgggccattggcaccggcgaagtc
gcccaggacgaggacatccgcgaggcccacgccaccgtgcgcggccttttggcggaccgg
ctctctgcggccgcggatatccgtatcctctacggcggctcggtcaagccggccaattgc
gcccagatcctcagtcttgacaatgtcaacggagtcctggtaggtggcgcaagtttgcag
gccgcgagttttgtggacatcgtctccgcaggactgtag

DBGET integrated database retrieval system