KEGG   Desulfohalobium retbaense: Dret_1549Help
Entry
Dret_1549         CDS       T00989                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
drt  Desulfohalobium retbaense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dret_1549
   01230 Biosynthesis of amino acids
    Dret_1549
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_1549
   00051 Fructose and mannose metabolism
    Dret_1549
   00562 Inositol phosphate metabolism
    Dret_1549
Enzymes [BR:drt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dret_1549
Exosome [BR:drt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dret_1549
  Exosomal proteins of bladder cancer cells
   Dret_1549
  Exosomal proteins of melanoma cells
   Dret_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1792723..1793481)
Genome map
AA seq 252 aa AA seqDB search
MPKPLMAANWKMFKTSTQALEFFEDFSETLDSTVLKDRDVLFLPPFTSLEALSDPVRFAG
FSIGAQNCYPAAEGAFTGEIAPGMLLDLGCDYVLTGHSERRHVLGESDEFVGQKTAFALD
QGLGVILCIGETLEQRKAGQVETVLKRQLESGLRDVPNDVPAEALTIAYEPVWAIGTGEV
AQDEDIREAHATVRGLLADRLSAAADIRILYGGSVKPANCAQILSLDNVNGVLVGGASLQ
AASFVDIVSAGL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaacccctcatggccgccaattggaagatgttcaagacgagcacccaggccctg
gagttttttgaagacttttccgagaccctcgacagcacggtcctcaaggaccgcgacgtg
ctttttctgccgccgtttacctccctggaagccctgtcggatccagtgcgtttcgcgggc
ttcagcatcggcgcccagaactgctacccggccgccgaaggcgccttcaccggggagatt
gccccggggatgcttttggatctcggctgcgactatgtgttgaccggccattccgagcgc
cgccacgtcctcggcgaatcggacgaattcgtgggccagaagactgccttcgctctggac
caggggctcggggtcatcctgtgcatcggcgagacactggagcagcgcaaggcggggcag
gtggaaaccgtcctcaagcgtcagcttgaaagcggcctgcgcgacgttcccaatgacgtg
cccgccgaagccctgaccatcgcctacgaaccggtctgggccattggcaccggcgaagtc
gcccaggacgaggacatccgcgaggcccacgccaccgtgcgcggccttttggcggaccgg
ctctctgcggccgcggatatccgtatcctctacggcggctcggtcaagccggccaattgc
gcccagatcctcagtcttgacaatgtcaacggagtcctggtaggtggcgcaagtttgcag
gccgcgagttttgtggacatcgtctccgcaggactgtag

DBGET integrated database retrieval system