KEGG   Desulfohalobium retbaense: Dret_1572Help
Entry
Dret_1572         CDS       T00989                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
drt  Desulfohalobium retbaense
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dret_1572
   00052 Galactose metabolism
    Dret_1572
   00500 Starch and sucrose metabolism
    Dret_1572
   00520 Amino sugar and nucleotide sugar metabolism
    Dret_1572
Enzymes [BR:drt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dret_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1820072..1821490)
Genome map
AA seq 472 aa AA seqDB search
MSDTANFQPFAAKMHNAGLRPELIDLFREYYQQLASGHTGKLSEAAIRPLDKANDLLHQD
DLTAEAGTNGRHTLDQTVMIKLNGGLGTSMGMPYAKSLLEVKQGNNFLDVIVMQCNGCDG
QLQYSIPLALMDSFATHQETNDYLQQQGIRLGQDVFTFLQHKFPKIRQDTLEPATYPEDP
ELEWNPPGHGDIYAALETSGLLNQLLSDGYRYAFVSNSDNLGAVVDSRLLGAFADSGTPF
MIEVCRRTGADTKGGHLARHKDGRLILREIAQCPDEELDAFQDVERFKYFNTNNIWIDLQ
QLRDFIDAHGFPQLPIIVNPKTVNPRDENSTPVFQIETAMGAAVAAFPGALAVQVNRDRF
IPVKKTNDLLAVWSDCYIFTPDCRIVPNPERRLGTIVIKLDSTYFKKIEQLTERFQHGAP
SLVACSSLTIHGDFAFGPNVVCRDDVVLENRGTEQVVIPEGTVLEGKQVWGA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccgccaattttcagccctttgcggcaaagatgcataatgccggactgcgt
cccgaactgatcgatttgtttcgggagtattaccaacaattggcttcgggacacaccggc
aaactctcagaggccgcgatccgtccactggataaagccaatgatctcttgcaccaggac
gatcttactgctgaagcgggaacaaatggtcgtcataccctggatcagacagtcatgatc
aagctcaacggcggcctgggcacgagtatgggaatgccgtatgccaagtcgttactggaa
gtcaaacagggcaataattttctcgacgtcattgtcatgcagtgcaacgggtgtgacggc
cagttgcagtattcgattccgctggcgctgatggacagctttgccacgcatcaggagacc
aacgactatctgcagcagcaggggatccgcctcggtcaggacgtcttcacgtttttgcag
cacaaattccccaagatccgccaggacactctcgagcccgcgacctatcccgaggatccg
gaattagagtggaaccctcccggccacggcgacatttacgctgccctggaaacctcgggt
ctgctcaaccagctcttgagcgacgggtaccgctacgcctttgtctccaattcggacaat
ctcggcgcggtcgtggattcccgtttgctgggcgcgtttgccgacagtggcactccgttc
atgatcgaggtctgccggcgcaccggggcggacaccaaaggcgggcatttggcccggcac
aaggacgggcgcctcatcctgcgggaaatcgcccaatgtccggatgaggaactcgacgcc
tttcaggatgtcgagcgcttcaaatatttcaataccaataatatctggatcgatctccag
cagctgcgggattttatcgatgctcacggttttccccaactcccgatcatcgtcaatccc
aaaaccgtcaatccccgagacgagaattcgacccctgtcttccagatcgagacggcgatg
ggggccgcggtggccgcgtttccgggagccctggccgtccaggtcaaccgggatcgattc
atcccggtcaaaaagacgaatgacctgctggcagtgtggtcggattgctatatctttacc
cctgattgccgcatcgtccccaatcccgagcggcgcttggggaccatcgtcatcaagctc
gattcgacgtattttaagaagatcgagcagttgaccgagcggttccagcacggcgcgcct
tcgttggtggcctgttcgtccctgaccatacacggcgatttcgcctttggccccaatgtt
gtgtgtcgcgacgatgtcgttttagaaaaccgcggcacggagcaagtcgttatccccgaa
ggtacggtcctggagggtaaacaggtctggggggcataa

DBGET integrated database retrieval system