KEGG   Desulfohalobium retbaense: Dret_1885Help
Entry
Dret_1885         CDS       T00989                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
drt  Desulfohalobium retbaense
Brite
Enzymes [BR:drt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Dret_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2166314..2167564
Genome map
AA seq 416 aa AA seqDB search
MRFNVVLTTTICLALLLPSLGSGAEDIQWTDQEKRLIASMQLDKLPPLPDDPSNDVDTDP
AAARFGEKVFHDARFSANDKISCATCHPEDKSFQDGRPVAVGVGRVTRRTMPLIAVAYND
WFFWDGRKDTLWSQTLAPIENPREHGISRTGCVELIRSQYRDEYEAVFGPLPKLPANLPS
IAMPVEFDQDALEAWRELDPAVRDTINTIFANTGKALAAYVRVILPSEAPFDRFAADLAA
GNENQADGHLSQKQQAGLKLFIGDAGCFGCHFGPRLTNDGFHDTGVNEAFGPEFDAGRAK
GITQVQHDMFNCMGDYSDAEPKECSALRFMDTDQDKYRQAFKTPTLRNVAVRPPYMHAGQ
IETLEEVIDFYAKESETNPELTHADLTEEKKDALIAFMESLTSDVTPRMDEVLNSQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcaatgtcgtactgaccaccaccatctgcctcgccctgcttctcccctcgctt
ggttcgggcgctgaggacatccaatggacggaccaggagaagcgtcttatcgccagcatg
caattggacaagctgccgcccctgccggacgatccgtcgaatgatgtggacacggacccg
gctgcggcgcgctttggggaaaaggtctttcacgatgcccggttcagtgccaacgacaag
atttcctgcgccacctgccacccggaagacaaatccttccaggacgggcgtccagtggcc
gtcggcgtgggccgcgtgacgcggcggaccatgccgcttatcgctgtggcctataacgac
tggtttttctgggacggacgcaaggacaccctctggagccagacgctggccccgatcgaa
aacccccgggaacacggtatcagccggaccggttgtgtggagttgatccggtcccaatac
cgcgacgagtacgaggcggttttcgggccgctccccaagctgcccgccaacctcccgtcc
atcgccatgcccgtggaattcgatcaggacgccctcgaggcgtggcgggagcttgatccg
gcggtgcgggacacaatcaacaccattttcgccaacaccggcaaggcactggccgcctat
gtccgcgttatcctgcccagcgaagcgccgtttgaccgcttcgccgccgacttggcagcc
ggcaacgagaatcaggccgatggccatctgtcacaaaaacagcaagccgggctgaagctc
tttatcggcgatgcgggctgcttcggctgccacttcggtccccggctgaccaacgacggc
ttccacgacaccggcgtcaacgaggccttcggtccggaattcgatgccggacgggccaaa
ggcattacccaggtccagcacgacatgttcaactgcatgggggactattccgacgccgag
cccaaggagtgttcggcgctgcgattcatggacacggatcaggacaaataccgccaggcc
ttcaagaccccgacactgcgcaacgtggctgtccgcccgccgtacatgcacgccgggcag
atcgagaccctggaagaagtcatcgacttctacgccaaggaaagcgagaccaatcctgaa
ctgacccacgccgatctgacagaagagaaaaaagacgcgctgatcgcctttatggagtcg
ctgaccagcgatgtcacgccgaggatggacgaagttttgaactctcaataa

DBGET integrated database retrieval system