KEGG   Desulfohalobium retbaense: Dret_2114Help
Entry
Dret_2114         CDS       T00989                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
drt  Desulfohalobium retbaense
Pathway
drt00010  Glycolysis / Gluconeogenesis
drt00030  Pentose phosphate pathway
drt00051  Fructose and mannose metabolism
drt00052  Galactose metabolism
drt00680  Methane metabolism
drt01100  Metabolic pathways
drt01110  Biosynthesis of secondary metabolites
drt01120  Microbial metabolism in diverse environments
drt01130  Biosynthesis of antibiotics
drt01200  Carbon metabolism
drt01230  Biosynthesis of amino acids
drt03018  RNA degradation
Module
drt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:drt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dret_2114
   00030 Pentose phosphate pathway
    Dret_2114
   00051 Fructose and mannose metabolism
    Dret_2114
   00052 Galactose metabolism
    Dret_2114
  Energy metabolism
   00680 Methane metabolism
    Dret_2114
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dret_2114
Enzymes [BR:drt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dret_2114
Protein phosphatases and associated proteins [BR:drt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dret_2114
Messenger RNA biogenesis [BR:drt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dret_2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACV69398
UniProt: C8X4C4
Position
2404468..2405781
Genome map
AA seq 437 aa AA seqDB search
MHTLHELNTAIETLGPAKIPSPLPFGRFIQDSKQLPIHISQEVLDEAPDEPMSFEFTEAG
PRDKIYFDPSKTKCAIVTCGGLCPGINDVIRSIVLAAHHNYGLASIVGIRYGLEGFCPQY
GHETVELTPRVVSDIHEFGGTMLGSSRGHQSAEEIVDALERMNINILFMIGGDGTMKAAS
KIVEEIKDRGLKISVIGVPKTIDNDIYFVTNSFGFTTAVSKATEAIRCAHTEANGAPNGI
GMVKLMGRESGFIAAEATLALKEVNFVLVPEDEFDLHGPNGFLASLEQRIKDRGHAVVVV
AEGAGQNLCAVNGKSGATDASGNPVLCDICDLLRQEIKTHFDNAGLPFTLKFIDPSYIIR
SVPADPGDRVYCGFLGQHAVHAAMSGKTNMVVSRLQDNFVYLPLSLVTQKRRKLNINSNY
WRAVLESTGQPIQMRNA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcacacattgcacgagttgaatacggccattgaaaccttgggaccggccaagatcccc
tcccccttaccgttcgggcgttttattcaagacagcaagcaactgccgatccatatctct
caggaggttttggacgaggccccggacgaaccgatgtcctttgaattcaccgaggctggc
ccacgggacaaaatctacttcgacccctcgaaaacgaaatgcgccattgtcacctgcggc
ggactctgccccgggatcaacgatgtcatccgctccatcgtcctggccgcccaccacaac
tacggcctggcatccatcgtcggcatccgctacggactcgagggcttttgtccccaatac
gggcatgaaactgtagaactcaccccccgggtggtctccgacatccatgaattcggcggc
accatgctcggctcttcccgcggccaccaatccgccgaagaaattgtcgacgccctggaa
cggatgaacatcaacatcctgttcatgatcggcggagacggaaccatgaaggcggcctcg
aaaatcgtggaggagatcaaagacagaggcctgaagatcagtgtgatcggcgtcccgaaa
accatcgacaacgatatctatttcgttaccaactcttttgggttcaccaccgcggtcagc
aaggccaccgaggccatccgctgcgcccacaccgaggccaatggcgcccctaacggcatc
ggcatggtcaagctcatgggccgggaatccgggtttatcgccgccgaagcgacgctggcc
ctaaaggaagtcaatttcgtgcttgtccccgaagacgagttcgacctccatggtcccaac
ggatttttggcctccctggaacagcggatcaaagacagaggccacgccgtggtggttgtc
gccgaaggggctgggcaaaatctgtgcgcagtgaacgggaaaagcggcgccaccgatgcc
tcgggcaacccggttctgtgcgacatctgcgacctcttgcgccaggagatcaaaacccat
ttcgacaacgccggcctgccgttcaccctcaaattcattgacccgagctatatcatccgt
tccgtgcccgctgatccgggagaccgcgtctattgcggattcctcggacagcacgccgtg
cacgcggccatgagtggcaaaaccaatatggtcgtcagccggctgcaggacaattttgtc
tacctgccgctctcgctggtgacccagaagcgccggaaactcaacatcaattcgaactac
tggcgggcggtgctggaatcgacgggacaaccgatccaaatgcgcaacgcctga

DBGET integrated database retrieval system