KEGG   Desulfohalobium retbaense: Dret_2114Help
Entry
Dret_2114         CDS       T00989                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
drt  Desulfohalobium retbaense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:drt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:drt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:drt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:drt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:drt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:drt00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:drt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2404468..2405781
Genome map
AA seq 437 aa AA seqDB search
MHTLHELNTAIETLGPAKIPSPLPFGRFIQDSKQLPIHISQEVLDEAPDEPMSFEFTEAG
PRDKIYFDPSKTKCAIVTCGGLCPGINDVIRSIVLAAHHNYGLASIVGIRYGLEGFCPQY
GHETVELTPRVVSDIHEFGGTMLGSSRGHQSAEEIVDALERMNINILFMIGGDGTMKAAS
KIVEEIKDRGLKISVIGVPKTIDNDIYFVTNSFGFTTAVSKATEAIRCAHTEANGAPNGI
GMVKLMGRESGFIAAEATLALKEVNFVLVPEDEFDLHGPNGFLASLEQRIKDRGHAVVVV
AEGAGQNLCAVNGKSGATDASGNPVLCDICDLLRQEIKTHFDNAGLPFTLKFIDPSYIIR
SVPADPGDRVYCGFLGQHAVHAAMSGKTNMVVSRLQDNFVYLPLSLVTQKRRKLNINSNY
WRAVLESTGQPIQMRNA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcacacattgcacgagttgaatacggccattgaaaccttgggaccggccaagatcccc
tcccccttaccgttcgggcgttttattcaagacagcaagcaactgccgatccatatctct
caggaggttttggacgaggccccggacgaaccgatgtcctttgaattcaccgaggctggc
ccacgggacaaaatctacttcgacccctcgaaaacgaaatgcgccattgtcacctgcggc
ggactctgccccgggatcaacgatgtcatccgctccatcgtcctggccgcccaccacaac
tacggcctggcatccatcgtcggcatccgctacggactcgagggcttttgtccccaatac
gggcatgaaactgtagaactcaccccccgggtggtctccgacatccatgaattcggcggc
accatgctcggctcttcccgcggccaccaatccgccgaagaaattgtcgacgccctggaa
cggatgaacatcaacatcctgttcatgatcggcggagacggaaccatgaaggcggcctcg
aaaatcgtggaggagatcaaagacagaggcctgaagatcagtgtgatcggcgtcccgaaa
accatcgacaacgatatctatttcgttaccaactcttttgggttcaccaccgcggtcagc
aaggccaccgaggccatccgctgcgcccacaccgaggccaatggcgcccctaacggcatc
ggcatggtcaagctcatgggccgggaatccgggtttatcgccgccgaagcgacgctggcc
ctaaaggaagtcaatttcgtgcttgtccccgaagacgagttcgacctccatggtcccaac
ggatttttggcctccctggaacagcggatcaaagacagaggccacgccgtggtggttgtc
gccgaaggggctgggcaaaatctgtgcgcagtgaacgggaaaagcggcgccaccgatgcc
tcgggcaacccggttctgtgcgacatctgcgacctcttgcgccaggagatcaaaacccat
ttcgacaacgccggcctgccgttcaccctcaaattcattgacccgagctatatcatccgt
tccgtgcccgctgatccgggagaccgcgtctattgcggattcctcggacagcacgccgtg
cacgcggccatgagtggcaaaaccaatatggtcgtcagccggctgcaggacaattttgtc
tacctgccgctctcgctggtgacccagaagcgccggaaactcaacatcaattcgaactac
tggcgggcggtgctggaatcgacgggacaaccgatccaaatgcgcaacgcctga

DBGET integrated database retrieval system